BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10449 (467 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF024502-6|AAB70378.4| 402|Caenorhabditis elegans Hypothetical ... 28 3.8 AL110482-4|CAB60337.1| 371|Caenorhabditis elegans Hypothetical ... 27 6.7 >AF024502-6|AAB70378.4| 402|Caenorhabditis elegans Hypothetical protein M151.1 protein. Length = 402 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 265 RYANFALDENVLSHYGTNFEMERETILFVV 354 +Y NF D+ + H+G N E E++ F + Sbjct: 18 QYPNFTTDQQQIFHFGMNIEARYESMEFQI 47 >AL110482-4|CAB60337.1| 371|Caenorhabditis elegans Hypothetical protein Y39G8B.3 protein. Length = 371 Score = 27.1 bits (57), Expect = 6.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 334 ETILFVVLCYFKINTLVIICTVYLYIRN 417 E ++FVV YF I + +IC V + +N Sbjct: 38 EFMMFVVTVYFAIRCVFVICKVRAFHKN 65 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,146,045 Number of Sequences: 27780 Number of extensions: 177742 Number of successful extensions: 475 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 839684522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -