BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10445 (486 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 60 4e-11 Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. 25 1.8 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 2.4 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 23 4.2 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 7.3 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 7.3 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 7.3 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 7.3 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 7.3 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 60.1 bits (139), Expect = 4e-11 Identities = 29/70 (41%), Positives = 39/70 (55%) Frame = +3 Query: 3 EAKEDDHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVP 182 E K+DDH + F Y LP + AD+ + L+SDG L +T P E + KN ER +P Sbjct: 45 EEKQDDHGYVSRHFVRRYMLPKGHNEADIVSSLSSDGILTITCPRKE--IEQKNEERSIP 102 Query: 183 IVETGAPYKK 212 I TG P K+ Sbjct: 103 ITHTGQPMKQ 112 >Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. Length = 101 Score = 24.6 bits (51), Expect = 1.8 Identities = 15/55 (27%), Positives = 22/55 (40%) Frame = +1 Query: 250 TFYDSGAEDISSSGSDCSTGTRGEERTDHALRTR*SDRKRQRDPTRKRSFCLSDN 414 T+ + ++ S S GEE D +L +D RDP R F + N Sbjct: 32 TYDEEDFDEESLKPHSSSPSDDGEEEFDPSLLEEHADAPTARDPGRNPEFLRNSN 86 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 24.2 bits (50), Expect = 2.4 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 322 ERTDHALRTR*SDRKRQRDPTRKRSFCLSDNL 417 ER +LRT D KR +PT + +SDNL Sbjct: 471 ERVQASLRTLRQDHKRTLNPTPYK-VAVSDNL 501 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 23.4 bits (48), Expect = 4.2 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 99 LTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPYKKDE 218 L + GYL++ P+SE + T+ + + G ++E Sbjct: 533 LLTHGYLIMQVPVSEGCGPFRGTQYMYQLFMQGILKLREE 572 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 22.6 bits (46), Expect = 7.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 1 KKLKKTTMTCSPASSSTP 54 KK +K + TC +S STP Sbjct: 351 KKKRKMSTTCDNSSPSTP 368 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 22.6 bits (46), Expect = 7.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 1 KKLKKTTMTCSPASSSTP 54 KK +K + TC +S STP Sbjct: 351 KKKRKMSTTCDNSSPSTP 368 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 22.6 bits (46), Expect = 7.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 1 KKLKKTTMTCSPASSSTP 54 KK +K + TC +S STP Sbjct: 303 KKKRKMSTTCDNSSPSTP 320 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 22.6 bits (46), Expect = 7.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 1 KKLKKTTMTCSPASSSTP 54 KK +K + TC +S STP Sbjct: 311 KKKRKMSTTCDNSSPSTP 328 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 329 VLSSPRVPVLQSLPLELMSSAPES*NVQGFYC 234 V ++P +PV PL SSA S + G C Sbjct: 227 VHTAPAIPVSSCSPLSTASSASCSSSAAGSLC 258 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 392,737 Number of Sequences: 2352 Number of extensions: 7018 Number of successful extensions: 17 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42708759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -