BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10442 (630 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 25 0.46 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 25 0.80 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 4.3 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 5.7 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 7.5 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 25.4 bits (53), Expect = 0.46 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 130 ILSKKA*CALSSVEHFAMTLYTYCSFW 50 +L++K A + +H T+YT C W Sbjct: 835 VLTRKIPEAFNESKHIGFTMYTTCVIW 861 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 24.6 bits (51), Expect = 0.80 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 261 TLSNRHADCLSPLSQMSVLYKVSFVSVTLSNTIFAKLQDYC 383 TLS +HA + L +S L V + +F L +YC Sbjct: 286 TLSTQHAKSQASLPPVSYLKAVDAFMSVCTVFVFMALMEYC 326 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 22.2 bits (45), Expect = 4.3 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = -3 Query: 67 TYCSFWN 47 TYC+FWN Sbjct: 572 TYCAFWN 578 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +2 Query: 131 LAIDHKNKENTAKIQRKNKTKQKSYILS 214 + + K K+N + R N T++ Y+L+ Sbjct: 351 MVVSMKIKQNVPQSGRVNNTQRNEYLLA 378 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 7.5 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 187 FIFSLDFCSVFFIFVINCQILSKKA*CALS 98 ++F FC + F + C S CA+S Sbjct: 91 WVFGPRFCDTWIAFDVMCSTASILNLCAIS 120 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,625 Number of Sequences: 438 Number of extensions: 2650 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -