BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10438 (419 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 52 6e-09 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 24 2.0 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 24 2.0 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 24 2.0 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 24 2.0 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 24 2.0 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 2.0 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 24 2.0 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 24 2.0 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 24 2.0 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 2.0 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 2.0 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 2.0 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 2.0 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 2.0 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 24 2.0 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 2.0 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 2.0 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 24 2.0 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 24 2.0 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 24 2.0 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 24 2.0 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 24 2.0 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 24 2.0 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 24 2.0 AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding pr... 23 4.5 AF437888-1|AAL84183.1| 154|Anopheles gambiae odorant binding pr... 23 4.5 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 6.0 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 22 7.9 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 22 7.9 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 52.4 bits (120), Expect = 6e-09 Identities = 28/74 (37%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Frame = +3 Query: 15 DFIEGLRHFDKDGNGFISSAELRHLLSTLGEKLSDDEVEQLLQ---GQEDSQGNINYENF 185 DF+E L+ +DK+ +G + AEL H L+ LGE+L D E++ +++ ED GNI Y F Sbjct: 86 DFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMKDCMDPEDDDGNIPYAPF 145 Query: 186 VHLIMQG*VLGHHL 227 + +M V+ H+ Sbjct: 146 LKKMMDNMVVIDHV 159 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 242 FSQNLEHFDLRGNGF 256 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 18 FIEGLRHFDKDGNGF 62 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding protein AgamOBP5 protein. Length = 156 Score = 23.0 bits (47), Expect = 4.5 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 133 NSCRDKKTLREISTMRTLFTSSCRAEF 213 +SCRD + + S +T +++ C AE+ Sbjct: 122 HSCRDVQGRYKDSCDKTFYSTKCLAEY 148 >AF437888-1|AAL84183.1| 154|Anopheles gambiae odorant binding protein protein. Length = 154 Score = 23.0 bits (47), Expect = 4.5 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 133 NSCRDKKTLREISTMRTLFTSSCRAEF 213 +SCRD + + S +T +++ C AE+ Sbjct: 120 HSCRDVQGRYKDSCDKTFYSTKCLAEY 146 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.6 bits (46), Expect = 6.0 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 7 LLMTLLRVCAILTKMAMGSSLLRNCDTCSL--LSERS 111 LL+ L +IL + ++NC +CS+ +S+RS Sbjct: 322 LLLILFLCVSILGTLITPELWMKNCKSCSISPVSDRS 358 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 22.2 bits (45), Expect = 7.9 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +1 Query: 28 VCAILTKMAMGSSLLRNCDTCSLLSERS 111 VC ++ + + ++ CDT L+ E+S Sbjct: 5 VCIVVFALVTPNLIVAECDTKGLIVEKS 32 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 22.2 bits (45), Expect = 7.9 Identities = 6/11 (54%), Positives = 11/11 (100%) Frame = +2 Query: 71 CGTATPALYSR 103 CG++TPA+Y++ Sbjct: 356 CGSSTPAIYTK 366 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 365,073 Number of Sequences: 2352 Number of extensions: 6417 Number of successful extensions: 52 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -