BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10436 (720 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08800.1 68417.m01449 protein kinase, putative similar to dua... 84 1e-16 At1g72710.1 68414.m08408 casein kinase, putative similar to case... 81 1e-15 At1g03930.1 68414.m00378 protein kinase (ADK1) identical to dual... 81 1e-15 At2g19470.1 68415.m02276 casein kinase, putative similar to case... 80 1e-15 At4g28880.1 68417.m04127 casein kinase, putative similar to simi... 80 2e-15 At4g26100.3 68417.m03758 casein kinase, putative similar to case... 80 2e-15 At4g26100.1 68417.m03757 casein kinase, putative similar to case... 80 2e-15 At3g23340.1 68416.m02944 casein kinase, putative similar to case... 80 2e-15 At5g44100.1 68418.m05396 casein kinase, putative similar to dual... 79 2e-15 At5g57015.1 68418.m07116 casein kinase, putative similar to case... 78 5e-15 At4g28540.1 68417.m04083 casein kinase, putative similar to case... 78 7e-15 At4g14340.1 68417.m02208 casein kinase I (CKI1) identical to cas... 77 1e-14 At4g28860.1 68417.m04124 casein kinase, putative similar to case... 77 2e-14 At1g04440.1 68414.m00435 casein kinase, putative similar to case... 75 4e-14 At5g43320.1 68418.m05294 casein kinase, putative similar to case... 75 6e-14 At3g03940.1 68416.m00412 protein kinase family protein contains ... 35 0.047 At5g18190.1 68418.m02135 protein kinase family protein contains ... 34 0.082 At2g25760.2 68415.m03092 protein kinase family protein contains ... 30 1.8 At2g25760.1 68415.m03091 protein kinase family protein contains ... 30 1.8 At2g33800.1 68415.m04147 ribosomal protein S5 family protein con... 29 2.3 At3g47110.1 68416.m05115 leucine-rich repeat transmembrane prote... 29 4.1 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 28 5.4 At1g07520.1 68414.m00805 scarecrow transcription factor family p... 28 5.4 At3g14590.1 68416.m01847 C2 domain-containing protein low simila... 28 7.2 At5g04380.1 68418.m00430 S-adenosyl-L-methionine:carboxyl methyl... 27 9.5 >At4g08800.1 68417.m01449 protein kinase, putative similar to dual specificity kinase 1 gi|1216484|gb|AAB47968; contains protein kinase domain, Pfam:PF00069 Length = 285 Score = 83.8 bits (198), Expect = 1e-16 Identities = 32/51 (62%), Positives = 43/51 (84%) Frame = +2 Query: 5 HPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLK 157 HPIEF Y+ YCR LRF+++PDYA+L++LFR LF R+GF +D+VFDW +LK Sbjct: 212 HPIEFATYIHYCRSLRFDDKPDYAYLKRLFRDLFIREGFQFDFVFDWTVLK 262 >At1g72710.1 68414.m08408 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158 Length = 465 Score = 80.6 bits (190), Expect = 1e-15 Identities = 31/52 (59%), Positives = 42/52 (80%) Frame = +2 Query: 5 HPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 +P EF Y YCR LRF+++PDYA+L++LFR LF R+GF +DYVFDW +LK+ Sbjct: 243 YPSEFASYFHYCRSLRFDDKPDYAYLKRLFRDLFIREGFQFDYVFDWTILKY 294 >At1g03930.1 68414.m00378 protein kinase (ADK1) identical to dual specificity kinase 1 (ADK1) [Arabidopsis thaliana] gi|1216484|gb|AAB47968; supported by cDNA gi:18700076 and gi:1216483. Note: differences between cDNAs in the 11th exon, possibly due to errors or alternative splicing. Length = 471 Score = 80.6 bits (190), Expect = 1e-15 Identities = 30/53 (56%), Positives = 43/53 (81%) Frame = +2 Query: 2 NHPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 N P EF Y +YCR LRF+++PDY++L++LFR LF R+G+ +DYVFDW +LK+ Sbjct: 243 NQPSEFVSYFRYCRSLRFDDKPDYSYLKRLFRDLFIREGYQFDYVFDWTVLKY 295 >At2g19470.1 68415.m02276 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 433 Score = 80.2 bits (189), Expect = 1e-15 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = +2 Query: 5 HPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 HP EF Y YCR LRF+++PDYA+L++LFR LF R+GF +D+VFDW + K+ Sbjct: 244 HPTEFASYFHYCRSLRFDDKPDYAYLKRLFRNLFIREGFQFDFVFDWTVYKY 295 >At4g28880.1 68417.m04127 casein kinase, putative similar to similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 415 Score = 79.8 bits (188), Expect = 2e-15 Identities = 28/53 (52%), Positives = 40/53 (75%) Frame = +2 Query: 2 NHPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 NHP+EF Y YC L F++RPDY L++LFR LF R+G+ +DY+FDW ++K+ Sbjct: 243 NHPVEFASYFHYCHTLTFDQRPDYGFLKRLFRDLFSREGYEFDYIFDWTIIKY 295 >At4g26100.3 68417.m03758 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 450 Score = 79.8 bits (188), Expect = 2e-15 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = +2 Query: 5 HPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 +P EF Y YCR LRF+++PDYA+L+++FR LF R+GF +DYVFDW +LK+ Sbjct: 244 YPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKY 295 >At4g26100.1 68417.m03757 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 450 Score = 79.8 bits (188), Expect = 2e-15 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = +2 Query: 5 HPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 +P EF Y YCR LRF+++PDYA+L+++FR LF R+GF +DYVFDW +LK+ Sbjct: 244 YPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKY 295 >At3g23340.1 68416.m02944 casein kinase, putative similar to casein kinase I [Arabidopsis thaliana] gi|1197461|emb|CAA55396 Length = 442 Score = 79.8 bits (188), Expect = 2e-15 Identities = 30/53 (56%), Positives = 43/53 (81%) Frame = +2 Query: 2 NHPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 ++P EF Y YCR LRFE++PDY++L++LFR LF R+G+ +DYVFDW +LK+ Sbjct: 243 SYPSEFTSYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQFDYVFDWTILKY 295 >At5g44100.1 68418.m05396 casein kinase, putative similar to dual specificity kinase 1 gi|1216484|gb|AAB47968 Length = 476 Score = 79.4 bits (187), Expect = 2e-15 Identities = 30/53 (56%), Positives = 42/53 (79%) Frame = +2 Query: 2 NHPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 N P EF Y YCR LRF+++PDY++L++LFR LF R+G+ +DYVFDW +LK+ Sbjct: 243 NQPSEFVSYFHYCRSLRFDDKPDYSYLKRLFRDLFIREGYQFDYVFDWTVLKY 295 >At5g57015.1 68418.m07116 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 435 Score = 78.2 bits (184), Expect = 5e-15 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +2 Query: 5 HPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 +P EF Y YCR LRF+++PDY +L+++FR LF R+GF +DYVFDW +LK+ Sbjct: 244 YPSEFASYFHYCRSLRFDDKPDYGYLKRIFRDLFIREGFQFDYVFDWTILKY 295 >At4g28540.1 68417.m04083 casein kinase, putative similar to casein kinase I [Arabidopsis thaliana] gi|1103318|emb|CAA55395; contains protein kinase domain, Pfam:PF00069 Length = 479 Score = 77.8 bits (183), Expect = 7e-15 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = +2 Query: 2 NHPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLK 157 ++P EF Y +YCR LRFE++PDY++L++LFR LF R+G+ +DYVFDW LK Sbjct: 247 SYPPEFVSYFQYCRSLRFEDKPDYSYLKRLFRDLFIREGYQFDYVFDWTALK 298 >At4g14340.1 68417.m02208 casein kinase I (CKI1) identical to casein kinase I [Arabidopsis thaliana] gi|1103318|emb|CAA55395 Length = 457 Score = 77.0 bits (181), Expect = 1e-14 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = +2 Query: 2 NHPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 ++P EF Y YCR LRFE++PDY++LR+LFR LF R+G+ DYVFDW + K+ Sbjct: 249 SYPSEFTSYFHYCRSLRFEDKPDYSYLRRLFRDLFIREGYQLDYVFDWTISKY 301 >At4g28860.1 68417.m04124 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 414 Score = 76.6 bits (180), Expect = 2e-14 Identities = 26/53 (49%), Positives = 40/53 (75%) Frame = +2 Query: 2 NHPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKF 160 +HP+EF Y YC L F++RPDY L++LFR LF R+G+ +DY++DW ++K+ Sbjct: 243 SHPVEFASYFHYCHTLTFDQRPDYGFLKRLFRDLFSREGYEFDYIYDWTIIKY 295 >At1g04440.1 68414.m00435 casein kinase, putative similar to casein kinase I [Arabidopsis thaliana] gi|1103318|emb|CAA55395; contains protein kinase domain, Pfam:PF00069 Length = 468 Score = 75.4 bits (177), Expect = 4e-14 Identities = 36/99 (36%), Positives = 54/99 (54%) Frame = +2 Query: 2 NHPIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKFGGLRDNH 181 N P EF Y Y R LRFE++PDY++L++LFR LF R+G+ +DYVFDW +L++ + Sbjct: 243 NFPPEFTSYFLYVRSLRFEDKPDYSYLKRLFRDLFIREGYQFDYVFDWTILRYPQFGSSS 302 Query: 182 QTSGIDRALRRLEQNQEQENTAATAASPVMQWQQFRNGG 298 ++ R R N + P+ Q + R G Sbjct: 303 SSNSKPRPTLRPAMNIPVPSADKAEKPPIGQDSRERFSG 341 >At5g43320.1 68418.m05294 casein kinase, putative similar to casein kinase I (CKI2) [Arabidopsis thaliana] gi|1103322|emb|CAA55397; contains protein kinase domain, Pfam:PF00069 Length = 480 Score = 74.5 bits (175), Expect = 6e-14 Identities = 33/73 (45%), Positives = 45/73 (61%) Frame = +2 Query: 8 PIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKFGGLRDNHQT 187 P EF Y Y R LRFE++PDY +L++LFR LF R+G+ +DYVFDW +LK+ + Sbjct: 245 PPEFTSYFLYVRSLRFEDKPDYPYLKRLFRDLFIREGYQFDYVFDWTILKYPQFSSGSSS 304 Query: 188 SGIDRALRRLEQN 226 S R+ R N Sbjct: 305 SSKPRSSLRPAMN 317 >At3g03940.1 68416.m00412 protein kinase family protein contains Pfam domains, PF00069: Protein kinase domain Length = 701 Score = 35.1 bits (77), Expect = 0.047 Identities = 28/90 (31%), Positives = 39/90 (43%) Frame = +2 Query: 8 PIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKFGGLRDNHQT 187 P F+L+L+ ++F+E P+YA L +F TL + D LK G R Sbjct: 386 PPPFKLFLEAVTNMKFDEEPNYAKLISIFDTLIEPCAISRPIRID-GALKVGQKR----- 439 Query: 188 SGIDRALRRLEQNQEQENTAATAASPVMQW 277 R L LE++ EQ SP QW Sbjct: 440 ---GRLLINLEED-EQPRKKIRIGSPATQW 465 >At5g18190.1 68418.m02135 protein kinase family protein contains Pfam domains, PF00069: Protein kinase domain Length = 691 Score = 34.3 bits (75), Expect = 0.082 Identities = 26/90 (28%), Positives = 40/90 (44%) Frame = +2 Query: 8 PIEFQLYLKYCRRLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFDWNMLKFGGLRDNHQT 187 P F+L+L+ ++F+E P+YA L +F +L + + D LK G R Sbjct: 376 PPPFKLFLEAVTNMKFDEEPNYAKLISIFDSLIEQCALSRPIKID-GALKVGQKR----- 429 Query: 188 SGIDRALRRLEQNQEQENTAATAASPVMQW 277 R L L+++ EQ SP QW Sbjct: 430 ---GRMLLNLDED-EQPKKKIRIGSPACQW 455 >At2g25760.2 68415.m03092 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 676 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 8 PIEFQLYLKYCRRLRFEERPDYAHLRQLF 94 P F+ +++Y L+F+E PDYA LF Sbjct: 358 PQPFRQFVEYVVNLKFDEEPDYAKYVSLF 386 >At2g25760.1 68415.m03091 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 673 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 8 PIEFQLYLKYCRRLRFEERPDYAHLRQLF 94 P F+ +++Y L+F+E PDYA LF Sbjct: 355 PQPFRQFVEYVVNLKFDEEPDYAKYVSLF 383 >At2g33800.1 68415.m04147 ribosomal protein S5 family protein contains Pfam profiles PF03719: Ribosomal protein S5, C-terminal domain, PF00333: Ribosomal protein S5, N-terminal domain Length = 303 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +2 Query: 161 GGLRDNHQTSGIDRAL-RRLEQNQEQENTAATAASPVMQWQQFRNGGEER 307 G +R + +G++ AL ++L N N AT A+ V Q +QFR+ +ER Sbjct: 246 GAVRIVLEMAGVENALGKQLGSNNALNNARATLAA-VQQMRQFRDVAQER 294 >At3g47110.1 68416.m05115 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21 receptor type precursor, Oryza sativa, PIR:A57676 Length = 1025 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 500 QNRECVVEV-HAHASSPAVLIICRGVLILSLSQLCLCKVH 384 Q + C VE+ H+S ++ IC ++ +L LCLC V+ Sbjct: 636 QLQPCSVELPRRHSSVRKIITICVSAVMAALLLLCLCVVY 675 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 28.3 bits (60), Expect = 5.4 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -3 Query: 211 SKSAINTTCLMVITQSSKL*HVPIKHVVICKSLPVEEGAKQLTQM-GVVGSLLKTKSP 41 +K+ +N T L + KH+++ K+LP K+L QM G GSL K P Sbjct: 430 AKAGVNVTSLEKFATRNGDEKNRSKHILLVKNLPFASTEKELAQMFGKFGSLDKIILP 487 >At1g07520.1 68414.m00805 scarecrow transcription factor family protein similar to GB:AAD24412 from [Arabidopsis thaliana] (Plant J. 18 (1), 111-119 (1999)); contains Pfam profile: PF03514 GRAS family transcription factor Length = 695 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 44 RLRFEERPDYAHLRQLFRTLFHRQGFTYDYVFD 142 R F+++P A L QLFR + G+ D+V D Sbjct: 639 RAGFKQKPVEAELVQLFREKMKKWGYHKDFVLD 671 >At3g14590.1 68416.m01847 C2 domain-containing protein low similarity to SP|Q16974 Calcium-dependent protein kinase C (EC 2.7.1.-) {Aplysia californica}; contains Pfam profile PF00168: C2 domain Length = 737 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -3 Query: 184 LMVITQSSKL*HVPIKHVVICKSLPVEEGAKQLTQMGVVGSLLKTKSPAV 35 + V+ +KL P + V ICK A +T G S++ KSP V Sbjct: 396 ITVLEDEAKLNDDPFEGVTICKEDMWASFASDVTNKGSFSSVVSDKSPRV 445 >At5g04380.1 68418.m00430 S-adenosyl-L-methionine:carboxyl methyltransferase family protein similar to SAM:salicylic acid carboxyl methyltransferase (SAMT) [GI:6002712][Clarkia breweri] and to SAM:benzoic acid carboxyl methyltransferase (BAMT)[GI:9789277][Antirrhinum majus] Length = 385 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 339 REMLSA*SQRYLSSPPFRNCCHCIT 265 R +L+ + L +P +R+CCHC T Sbjct: 231 RMVLTLIGRNTLDNPLYRDCCHCWT 255 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,632,249 Number of Sequences: 28952 Number of extensions: 284089 Number of successful extensions: 722 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -