BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10431 (834 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ... 28 1.4 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 4.3 SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein k... 26 7.6 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 26 7.6 SPAC3H8.10 |spo20|sec14|sec14 cytosolic factor family Sec14|Schi... 26 7.6 >SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 28.3 bits (60), Expect = 1.4 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 462 RVMVHVVGHRPDRRFFAL*RWSPRSLIVDSCSK 364 + +V + PD +FF + W P L + SC K Sbjct: 210 KFLVKLAKALPDAKFFGIFDWDPHGLCIYSCFK 242 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 4.3 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +3 Query: 33 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 197 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 198 SCA 206 S A Sbjct: 232 SDA 234 >SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein kinase Ppk5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 836 Score = 25.8 bits (54), Expect = 7.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 399 SPRSLIVDSCSKLEQHSTLSRSILLI 322 SP +L +CS L HST + L+ Sbjct: 28 SPNNLTEQTCSPLRAHSTFKEPVFLL 53 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 25.8 bits (54), Expect = 7.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 268 VKSAHFLTNRPKSAKSLINQKNRP 339 VK FLTN + SL+ Q NRP Sbjct: 675 VKDYDFLTNLNATTLSLLTQSNRP 698 >SPAC3H8.10 |spo20|sec14|sec14 cytosolic factor family Sec14|Schizosaccharomyces pombe|chr 1|||Manual Length = 286 Score = 25.8 bits (54), Expect = 7.6 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 823 NVEYSYSSFFNIIEAFIRVIAHERIHI 743 N + +SS FN+I+ F+ ++IHI Sbjct: 211 NAPWGFSSAFNLIKGFLDEATVKKIHI 237 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,304,490 Number of Sequences: 5004 Number of extensions: 67187 Number of successful extensions: 123 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 410448950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -