BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10431 (834 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 4e-25 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 2e-24 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 3e-24 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 6e-24 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 108 6e-24 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 108 6e-24 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 107 1e-23 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 107 1e-23 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 107 1e-23 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 107 1e-23 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 107 1e-23 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 107 1e-23 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 106 2e-23 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 106 2e-23 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 106 2e-23 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 106 3e-23 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 106 3e-23 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 6e-23 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 105 6e-23 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 104 8e-23 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 8e-23 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 8e-23 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 8e-23 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 1e-22 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 1e-22 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 1e-22 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 104 1e-22 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 1e-22 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 104 1e-22 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 103 1e-22 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 103 2e-22 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 103 2e-22 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 103 2e-22 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 103 2e-22 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 103 2e-22 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 103 2e-22 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 103 2e-22 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 103 2e-22 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 103 2e-22 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 103 2e-22 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 103 2e-22 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 103 2e-22 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 103 2e-22 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 103 2e-22 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 103 2e-22 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 103 2e-22 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 103 2e-22 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 103 2e-22 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 103 2e-22 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 103 2e-22 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 103 2e-22 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 103 2e-22 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 103 2e-22 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 103 2e-22 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 103 2e-22 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 103 2e-22 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 103 2e-22 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 103 2e-22 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 103 2e-22 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 103 2e-22 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 103 2e-22 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 103 2e-22 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 103 2e-22 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 103 2e-22 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 103 2e-22 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 103 2e-22 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 103 2e-22 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 103 2e-22 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 103 2e-22 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 103 2e-22 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 103 2e-22 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 103 2e-22 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 103 2e-22 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 103 2e-22 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 102 3e-22 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 102 3e-22 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 102 3e-22 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 102 3e-22 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 102 3e-22 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 102 3e-22 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 102 3e-22 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 102 3e-22 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 102 3e-22 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 102 3e-22 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 102 3e-22 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 102 3e-22 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 102 3e-22 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 102 3e-22 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 102 3e-22 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 102 3e-22 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 102 3e-22 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 102 3e-22 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 102 3e-22 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 102 3e-22 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 102 3e-22 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 102 3e-22 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 102 3e-22 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 102 3e-22 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 102 3e-22 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 102 3e-22 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 102 3e-22 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 102 3e-22 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 102 3e-22 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 102 3e-22 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 102 3e-22 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 102 3e-22 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 102 3e-22 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 102 3e-22 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 102 3e-22 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 102 3e-22 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 102 3e-22 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 102 3e-22 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 102 3e-22 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 102 3e-22 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 102 3e-22 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 102 3e-22 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 102 3e-22 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 102 3e-22 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 102 3e-22 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 102 3e-22 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 102 3e-22 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 102 3e-22 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 102 3e-22 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 102 3e-22 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 102 3e-22 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 102 3e-22 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 102 3e-22 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 112 bits (269), Expect = 4e-25 Identities = 53/70 (75%), Positives = 58/70 (82%) Frame = -1 Query: 270 NKNLTQF*QNINAYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS 91 NKN +F N + + ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS Sbjct: 201 NKNSKRFQGNSQSSKYCISAKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS 260 Query: 90 RRCKTTASEL 61 RRCKTTASEL Sbjct: 261 RRCKTTASEL 270 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 109 bits (263), Expect = 2e-24 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 243 NINAYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 64 N+ A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 440 NMGASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 497 Query: 63 L 61 L Sbjct: 498 L 498 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 109 bits (262), Expect = 3e-24 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = -1 Query: 246 QNINAYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++++ + P+ ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 518 ESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 577 Query: 66 E 64 E Sbjct: 578 E 578 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 108 bits (259), Expect = 6e-24 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 Q+RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 108 bits (259), Expect = 6e-24 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = -1 Query: 213 IQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 I++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 108 bits (259), Expect = 6e-24 Identities = 51/60 (85%), Positives = 55/60 (91%) Frame = -1 Query: 240 INAYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 + A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 175 VGASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 107 bits (257), Expect = 1e-23 Identities = 53/72 (73%), Positives = 61/72 (84%), Gaps = 1/72 (1%) Frame = -1 Query: 273 FNKNLTQF*QNINAYNLPFAIQ-VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFS 97 +++ L+ F +A +P A+ +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 60 WDEKLSVFEAVNSARLMPEAVSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFS 119 Query: 96 QSRRCKTTASEL 61 QSRRCKTTASEL Sbjct: 120 QSRRCKTTASEL 131 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 214 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 369 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 285 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 25 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 259 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 278 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 128 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +2 Query: 623 TLRVTTTPAALNAPLQGASGGTFR 694 TLRVTTTPAALNAPLQGAS FR Sbjct: 111 TLRVTTTPAALNAPLQGASHSPFR 134 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 579 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +2 Query: 623 TLRVTTTPAALNAPLQGASGGTFR 694 TLRVTTTPAALNAPLQGAS FR Sbjct: 562 TLRVTTTPAALNAPLQGASHSPFR 585 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 107 bits (256), Expect = 1e-23 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 493 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 106 bits (255), Expect = 2e-23 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 224 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 106 bits (255), Expect = 2e-23 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 267 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 106 bits (255), Expect = 2e-23 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 251 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 106 bits (255), Expect = 2e-23 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 193 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 106 bits (255), Expect = 2e-23 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 390 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 106 bits (254), Expect = 3e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 106 bits (254), Expect = 3e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 358 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 106 bits (254), Expect = 3e-23 Identities = 52/63 (82%), Positives = 55/63 (87%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*Y 55 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 2 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPG 59 Query: 54 DSL 46 D L Sbjct: 60 DPL 62 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 131 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 137 DAPCSGALSAAGVVVTRSV 155 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 106 bits (254), Expect = 3e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 106 bits (254), Expect = 3e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 106 bits (254), Expect = 3e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 106 bits (254), Expect = 3e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 61 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 119 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 105 bits (251), Expect = 6e-23 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = -1 Query: 222 PFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 P A ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 52 PQAPRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 103 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 105 bits (251), Expect = 6e-23 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = -1 Query: 228 NLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 70 +L ++I++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA Sbjct: 457 SLFYSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 509 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 104 bits (250), Expect = 8e-23 Identities = 48/55 (87%), Positives = 52/55 (94%), Gaps = 2/55 (3%) Frame = -1 Query: 225 LPFA--IQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +PF +++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 92 IPFVALLKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 146 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 104 bits (250), Expect = 8e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +3 Query: 66 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 206 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 108 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 104 bits (250), Expect = 8e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 Q+RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 164 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 211 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 95 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 101 DAPCSGALSAAGVVVTRSV 119 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 104 bits (250), Expect = 8e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +3 Query: 66 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 206 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 103 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 104 bits (249), Expect = 1e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 76 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCS ALSAAGVVVTRSV Sbjct: 82 DAPCSAALSAAGVVVTRSV 100 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 104 bits (249), Expect = 1e-22 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = -1 Query: 231 YNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 + PFAIQ WEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 104 bits (249), Expect = 1e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 85 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 104 bits (249), Expect = 1e-22 Identities = 51/69 (73%), Positives = 55/69 (79%) Frame = +2 Query: 2 RELVSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART 181 R+L +RG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART Sbjct: 35 RKLSNRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART 92 Query: 182 DRPSQQLRT 208 DRPSQQLR+ Sbjct: 93 DRPSQQLRS 101 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 104 bits (249), Expect = 1e-22 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = -1 Query: 231 YNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 + PFAIQ WEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 104 bits (249), Expect = 1e-22 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 51 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 194 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 49 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 60 DAPCSGALSAAGVVVTRSV 78 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 103 bits (248), Expect = 1e-22 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -1 Query: 213 IQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 53 LRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 101 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 103 bits (248), Expect = 1e-22 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 213 IQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 I +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 127 ITLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 175 >SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) Length = 1160 Score = 103 bits (248), Expect = 1e-22 Identities = 48/59 (81%), Positives = 52/59 (88%) Frame = -1 Query: 243 NINAYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 N ++ L + +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 842 NASSSQLVNSSSLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 900 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 103 bits (247), Expect = 2e-22 Identities = 49/65 (75%), Positives = 51/65 (78%) Frame = -1 Query: 261 LTQF*QNINAYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRC 82 + QF Y +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRC Sbjct: 389 IVQFGPGCFLYKRDLRQALRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRC 448 Query: 81 KTTAS 67 KTTAS Sbjct: 449 KTTAS 453 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 103 bits (247), Expect = 2e-22 Identities = 51/62 (82%), Positives = 55/62 (88%) Frame = -1 Query: 246 QNINAYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +N A + PF ++RNC EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 39 KNQGASHSPF--RLRNCGEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 96 Query: 66 EL 61 EL Sbjct: 97 EL 98 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 103 bits (247), Expect = 2e-22 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 213 IQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 I +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 295 ILLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 343 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 103 bits (247), Expect = 2e-22 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -1 Query: 234 AYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 A + PF ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 ASHSPF--RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +2 Query: 623 TLRVTTTPAALNAPLQGASGGTFR 694 TLRVTTTPAALNAPLQGAS FR Sbjct: 13 TLRVTTTPAALNAPLQGASHSPFR 36 >SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 103 bits (247), Expect = 2e-22 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 216 AIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 A ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 444 AHRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 493 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 476 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 103 bits (246), Expect = 2e-22 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -1 Query: 216 AIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 A +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 144 ACLLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 103 bits (246), Expect = 2e-22 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 213 IQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 + +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 366 VVLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 69 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 650 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 559 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 103 bits (246), Expect = 2e-22 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -1 Query: 216 AIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 A +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 31 ARMLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 80 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 103 bits (246), Expect = 2e-22 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -1 Query: 216 AIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 A +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 787 ACLLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 836 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 103 bits (246), Expect = 2e-22 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -1 Query: 216 AIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 A +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 369 ACLLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 418 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 1105 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 1152 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 110 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 486 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 533 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 94 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 141 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 192 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 918 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 266 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 313 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 14 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 61 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 68.9 bits (161), Expect = 5e-12 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 206 CATVGKGDRCGPLRYYASWRKGDVLQGD 123 CATVGKGDRCGPLRYYASWRKGDVLQGD Sbjct: 91 CATVGKGDRCGPLRYYASWRKGDVLQGD 118 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 232 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 279 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 72 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 119 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 103 bits (246), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 210 QVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 ++RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 23 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 81 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 87 DAPCSGALSAAGVVVTRSV 105 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 108 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 90 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 96 DAPCSGALSAAGVVVTRSV 114 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 82 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 88 DAPCSGALSAAGVVVTRSV 106 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 108 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 114 DAPCSGALSAAGVVVTRSV 132 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 113 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 119 DAPCSGALSAAGVVVTRSV 137 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 84 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 90 DAPCSGALSAAGVVVTRSV 108 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 104 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 110 DAPCSGALSAAGVVVTRSV 128 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 116 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 122 DAPCSGALSAAGVVVTRSV 140 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 92 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 98 DAPCSGALSAAGVVVTRSV 116 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 81 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 87 DAPCSGALSAAGVVVTRSV 105 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 71 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 96 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 102 DAPCSGALSAAGVVVTRSV 120 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 111 DAPCSGALSAAGVVVTRSV 129 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 99 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 105 DAPCSGALSAAGVVVTRSV 123 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 115 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 121 DAPCSGALSAAGVVVTRSV 139 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 103 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 109 DAPCSGALSAAGVVVTRSV 127 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 86 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 92 DAPCSGALSAAGVVVTRSV 110 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 262 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 268 DAPCSGALSAAGVVVTRSV 286 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 157 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 163 DAPCSGALSAAGVVVTRSV 181 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 95 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 74 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 62 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 93 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 99 DAPCSGALSAAGVVVTRSV 117 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 427 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 433 DAPCSGALSAAGVVVTRSV 451 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 153 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 159 DAPCSGALSAAGVVVTRSV 177 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 129 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 135 DAPCSGALSAAGVVVTRSV 153 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 85 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 91 DAPCSGALSAAGVVVTRSV 109 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 60 DAPCSGALSAAGVVVTRSV 78 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 64 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 84 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 90 DAPCSGALSAAGVVVTRSV 108 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 149 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 155 DAPCSGALSAAGVVVTRSV 173 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 91 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 97 DAPCSGALSAAGVVVTRSV 115 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 386 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 392 DAPCSGALSAAGVVVTRSV 410 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 126 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 132 DAPCSGALSAAGVVVTRSV 150 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 96 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 102 DAPCSGALSAAGVVVTRSV 120 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 62 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 111 DAPCSGALSAAGVVVTRSV 129 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 89 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 95 DAPCSGALSAAGVVVTRSV 113 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 180 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 186 DAPCSGALSAAGVVVTRSV 204 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 109 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 115 DAPCSGALSAAGVVVTRSV 133 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 85 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 91 DAPCSGALSAAGVVVTRSV 109 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 189 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 195 DAPCSGALSAAGVVVTRSV 213 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 879 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 62 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 106 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 112 DAPCSGALSAAGVVVTRSV 130 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 80 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 86 DAPCSGALSAAGVVVTRSV 104 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 119 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 125 DAPCSGALSAAGVVVTRSV 143 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 102 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 108 DAPCSGALSAAGVVVTRSV 126 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 224 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 115 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 121 DAPCSGALSAAGVVVTRSV 139 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 302 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 308 DAPCSGALSAAGVVVTRSV 326 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 160 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 96 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 102 DAPCSGALSAAGVVVTRSV 120 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 82 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 88 DAPCSGALSAAGVVVTRSV 106 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 83 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 89 DAPCSGALSAAGVVVTRSV 107 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 147 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 153 DAPCSGALSAAGVVVTRSV 171 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 160 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 166 DAPCSGALSAAGVVVTRSV 184 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 85 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 66 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 104 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 110 DAPCSGALSAAGVVVTRSV 128 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 83 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 89 DAPCSGALSAAGVVVTRSV 107 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 80 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 86 DAPCSGALSAAGVVVTRSV 104 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 57 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 65 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 442 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 448 DAPCSGALSAAGVVVTRSV 466 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 91 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 97 DAPCSGALSAAGVVVTRSV 115 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 100 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 106 DAPCSGALSAAGVVVTRSV 124 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 82 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 88 DAPCSGALSAAGVVVTRSV 106 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 165 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 171 DAPCSGALSAAGVVVTRSV 189 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 101 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 107 DAPCSGALSAAGVVVTRSV 125 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 111 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 117 DAPCSGALSAAGVVVTRSV 135 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 114 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 120 DAPCSGALSAAGVVVTRSV 138 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 460 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 466 DAPCSGALSAAGVVVTRSV 484 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 157 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 113 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 119 DAPCSGALSAAGVVVTRSV 137 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 102 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 108 DAPCSGALSAAGVVVTRSV 126 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 92 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 98 DAPCSGALSAAGVVVTRSV 116 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 207 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 213 DAPCSGALSAAGVVVTRSV 231 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 111 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 117 DAPCSGALSAAGVVVTRSV 135 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 98 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 104 DAPCSGALSAAGVVVTRSV 122 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 134 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 83 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 109 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 115 DAPCSGALSAAGVVVTRSV 133 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 88 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 81 DAPCSGALSAAGVVVTRSV 99 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 207 VRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 +RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 231 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 237 DAPCSGALSAAGVVVTRSV 255 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 80 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 86 DAPCSGALSAAGVVVTRSV 104 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 102 bits (245), Expect = 3e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 208 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 86 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 678 DAPCSGALSAAGVVVTRSV 622 DAPCSGALSAAGVVVTRSV Sbjct: 92 DAPCSGALSAAGVVVTRSV 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,540,089 Number of Sequences: 59808 Number of extensions: 551009 Number of successful extensions: 8852 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8845 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2347493764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -