BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10429 (423 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC244.02c |||U3 snoRNP-associated protein Utp6 |Schizosaccharo... 25 3.7 SPAC18G6.15 |mal3||EB1 family Mal3|Schizosaccharomyces pombe|chr... 24 8.5 >SPBC244.02c |||U3 snoRNP-associated protein Utp6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 488 Score = 25.4 bits (53), Expect = 3.7 Identities = 7/21 (33%), Positives = 16/21 (76%) Frame = -2 Query: 233 YIHFVHYSDLVFAVSILSKLC 171 ++ ++HY+ + AV+I+ K+C Sbjct: 110 WLDYIHYAQKIKAVNIVGKIC 130 >SPAC18G6.15 |mal3||EB1 family Mal3|Schizosaccharomyces pombe|chr 1|||Manual Length = 308 Score = 24.2 bits (50), Expect = 8.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 248 CGPGWAMLAYNQLRYNILRLIVLNGKCNKLY 340 CG G+AM+ Y + L +N +CN Y Sbjct: 26 CGKGYAMIQIFDSIYQDIPLKKVNFECNNEY 56 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,682,288 Number of Sequences: 5004 Number of extensions: 30155 Number of successful extensions: 57 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 150383836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -