BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10429 (423 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0663 + 5721902-5723176,5724162-5724233,5724405-5724560,572... 27 6.2 >08_01_0663 + 5721902-5723176,5724162-5724233,5724405-5724560, 5724655-5724844,5725173-5725255 Length = 591 Score = 27.1 bits (57), Expect = 6.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 2 NVVPVTGSKTFFILLKISRFVQVNMYVNCSVCAPD 106 N PV G + + LK R V+ + V+ S+CAP+ Sbjct: 239 NNCPVNGGEISSVSLKKLRMVKCLITVDLSICAPN 273 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,780,224 Number of Sequences: 37544 Number of extensions: 197521 Number of successful extensions: 326 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 325 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 778540620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -