BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10423 (837 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 2.9 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 23 8.7 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.0 bits (52), Expect = 2.9 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = -1 Query: 456 VDSTCTGPDIHNIQSGFRLKSXKF----TFRCSVGSCDVTNVRERCRDACSLSLSLKE 295 ++ C+ P H +R ++ + T++C + CD T +RC CS SL E Sbjct: 489 IEMLCSCPCEHPSDPEYRERADECSNAGTYKCGICECDGTYHGQRCE--CSAMESLLE 544 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 103 RRRACIRCISPSLSHACDVTRPYRACEC 186 R R+C+ + PS++ C+ R +R+ C Sbjct: 117 RTRSCLAALEPSVTDVCE--RAHRSFLC 142 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 873,394 Number of Sequences: 2352 Number of extensions: 18527 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -