BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10423 (837 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 4.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.1 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.6 bits (46), Expect = 4.6 Identities = 16/79 (20%), Positives = 37/79 (46%), Gaps = 5/79 (6%) Frame = +2 Query: 311 EREHASRHLSRTFVTSQDPTEHLNVNFXDFNRNPLCMLCI-----SGPVHVESTVHSSAR 475 E+ + + S++F ++ + H ++ + R C +C SG +H +H+ R Sbjct: 117 EKPYQCEYCSKSFSVKENLSVHRRIHTKE--RPYKCDVCERAFEHSGKLHRHMRIHTGER 174 Query: 476 TIRCSCQTSTINMSHGEVI 532 +C+ + T S G+++ Sbjct: 175 PHKCTVCSKTFIQS-GQLV 192 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 816 QPEEATKPDPRSGG 775 Q +EA KP P +GG Sbjct: 1017 QSQEANKPKPATGG 1030 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 245,659 Number of Sequences: 438 Number of extensions: 6030 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26824317 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -