BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10417 (839 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q77NK4 Cluster: Bcl-2 homolog; n=3; Cercopithecine herp... 37 0.72 >UniRef50_Q77NK4 Cluster: Bcl-2 homolog; n=3; Cercopithecine herpesvirus 17|Rep: Bcl-2 homolog - Rhesus monkey rhadinovirus H26-95 Length = 187 Score = 36.7 bits (81), Expect = 0.72 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 810 PPNHEAEVSV-VSVYCIRSSRSYCNLNKFEFLHFPIFVHFHKYLT 679 PP E E S+ V VY I YC L + E+LH P+F ++++ Sbjct: 10 PPEEENENSLPVDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFIS 54 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,781,515 Number of Sequences: 1657284 Number of extensions: 12579166 Number of successful extensions: 25691 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 24851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25688 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 73373641369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -