BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10417 (839 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY075331-1|AAL68198.1| 330|Drosophila melanogaster GH11935p pro... 30 3.4 AE014134-1455|AAF52636.2| 330|Drosophila melanogaster CG7830-PA... 30 3.4 >AY075331-1|AAL68198.1| 330|Drosophila melanogaster GH11935p protein. Length = 330 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -3 Query: 834 DITS*LAHPPNHEAEVSVVSVYCIRSSRSYCNLNKFEFLH 715 DIT + PPN+ V+++++ + S Y N EFL+ Sbjct: 172 DITIRIFRPPNYSGTVAMITLVALVGSFLYIRRNNLEFLY 211 >AE014134-1455|AAF52636.2| 330|Drosophila melanogaster CG7830-PA protein. Length = 330 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -3 Query: 834 DITS*LAHPPNHEAEVSVVSVYCIRSSRSYCNLNKFEFLH 715 DIT + PPN+ V+++++ + S Y N EFL+ Sbjct: 172 DITIRIFRPPNYSGTVAMITLVALVGSFLYIRRNNLEFLY 211 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,782,050 Number of Sequences: 53049 Number of extensions: 601584 Number of successful extensions: 972 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4003789140 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -