BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10417 (839 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016415-5|AAW88414.1| 305|Caenorhabditis elegans Serpentine re... 30 1.8 AF003386-7|AAB54258.2| 412|Caenorhabditis elegans Hypothetical ... 29 3.1 >AF016415-5|AAW88414.1| 305|Caenorhabditis elegans Serpentine receptor, class bc (class b-like) protein 30 protein. Length = 305 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -3 Query: 555 CVRGLVQCVYLSIGVNSTLSWRLTRYCQPRARHVYFYYHL*IID*C 418 CV G+V C + + +N+ L W++ R R + +Y+ ++D C Sbjct: 9 CVIGIV-CANIEVLLNANLVWKIVLKKSQRKREMGLFYYRFVLDVC 53 >AF003386-7|AAB54258.2| 412|Caenorhabditis elegans Hypothetical protein F59E12.8 protein. Length = 412 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 351 IISFIQFKSYKFVNVHQ*FFCIQGFVFSVLFKSFN 247 I+ F++FKS K + CIQ +F VL +FN Sbjct: 80 ILRFVEFKSTK--ETESSYECIQNSIFQVLLSTFN 112 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,903,208 Number of Sequences: 27780 Number of extensions: 334723 Number of successful extensions: 769 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2077023564 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -