Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10413
         (805 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    24   1.2  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    22   5.0  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   5.0  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    22   5.0  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   5.0  

>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +1

Query: 436 TAQTCGSGSHGHHHETARS*SYIPEQVRQHLARLPSIDPY 555
           T+Q     SH HHH+T+     +      HL  + S  PY
Sbjct: 124 TSQPPTDNSHVHHHQTSLL-GKVEGAATHHLGSVYSRHPY 162


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +3

Query: 570 HLWIPKCRKI 599
           H+W PKC ++
Sbjct: 480 HIWTPKCERL 489


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +3

Query: 570 HLWIPKCRKI 599
           H+W PKC ++
Sbjct: 480 HIWTPKCERL 489


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +3

Query: 570 HLWIPKCRKI 599
           H+W PKC ++
Sbjct: 480 HIWTPKCERL 489


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +3

Query: 570 HLWIPKCRKI 599
           H+W PKC ++
Sbjct: 480 HIWTPKCERL 489


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 202,214
Number of Sequences: 336
Number of extensions: 4445
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21895259
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)