BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10410 (821 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 2.8 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 8.6 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.0 bits (52), Expect = 2.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 615 CNDNMHYRTCARAKFNNF 562 CNDN+ R C R K N + Sbjct: 1007 CNDNVEGRRCDRCKENKY 1024 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.4 bits (48), Expect = 8.6 Identities = 12/59 (20%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = -3 Query: 813 TQQKLPCAYLTQYFTLLA-SILKNPKCRFAFYCRSKYPICKFFFFRRYIVLLDFLENYI 640 T + + Y Y L+ S+ + FA +C+ P C + F+ L + +++ Sbjct: 483 TDENMQYMYRKAYRDKLSFSVSNDQMISFAQFCKDTTPECNYTFWEWLYAALKIIRDHL 541 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 753,802 Number of Sequences: 2352 Number of extensions: 14271 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -