BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10410 (821 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC112053-1|AAI12054.1| 570|Homo sapiens FK506 binding protein 9... 31 5.0 BC101723-1|AAI01724.1| 570|Homo sapiens FK506 binding protein 9... 31 5.0 AF089745-1|AAC78853.1| 517|Homo sapiens FK506-binding protein p... 31 5.0 >BC112053-1|AAI12054.1| 570|Homo sapiens FK506 binding protein 9 protein. Length = 570 Score = 31.1 bits (67), Expect = 5.0 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = +3 Query: 591 FDSAYCRCK-FETYV---YMICSFRENLIKLCTYEKKKICI*DTLIYNK 725 FDS+Y R + F+TY+ Y+I E L+ +C EK++I + L Y + Sbjct: 295 FDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGE 343 >BC101723-1|AAI01724.1| 570|Homo sapiens FK506 binding protein 9, 63 kDa protein. Length = 570 Score = 31.1 bits (67), Expect = 5.0 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = +3 Query: 591 FDSAYCRCK-FETYV---YMICSFRENLIKLCTYEKKKICI*DTLIYNK 725 FDS+Y R + F+TY+ Y+I E L+ +C EK++I + L Y + Sbjct: 295 FDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGE 343 >AF089745-1|AAC78853.1| 517|Homo sapiens FK506-binding protein protein. Length = 517 Score = 31.1 bits (67), Expect = 5.0 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = +3 Query: 591 FDSAYCRCK-FETYV---YMICSFRENLIKLCTYEKKKICI*DTLIYNK 725 FDS+Y R + F+TY+ Y+I E L+ +C EK++I + L Y + Sbjct: 242 FDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGE 290 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,168,325 Number of Sequences: 237096 Number of extensions: 1787389 Number of successful extensions: 6448 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6448 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10259383312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -