BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10406 (813 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 29 0.058 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 24 1.3 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 24 1.7 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 3.8 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 28.7 bits (61), Expect = 0.058 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -1 Query: 93 NTFRFEGSGSRCNYTETLELVSQGGWRI 10 N+ ++ G Y E +EL +GGW++ Sbjct: 286 NSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +1 Query: 427 LNIKVNYI*TNVFVVELRVGLFSIVGLRVLNVFKYFIRGRQRKSGLTYPH 576 +N VN I N+ + R G F + G++++ + R RKS + H Sbjct: 344 INSAVNPILYNIISSKFRSGFFKLCGMKIVKKRRKDKREITRKSTSSSTH 393 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 364 RTRSTNSQFLALQKRFASHCWLNI 435 RT T Q LAL+K+F +L+I Sbjct: 119 RTPFTTQQLLALEKKFRDKQYLSI 142 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = -1 Query: 84 RFEGSGSRCNYTETLELVSQGGW 16 R+ G Y E +E + GGW Sbjct: 293 RYTGERGMMGYNEIVEAQNAGGW 315 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,738 Number of Sequences: 336 Number of extensions: 3610 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22206566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -