BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10406 (813 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51785| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 >SB_51785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 348 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/79 (24%), Positives = 42/79 (53%) Frame = +1 Query: 427 LNIKVNYI*TNVFVVELRVGLFSIVGLRVLNVFKYFIRGRQRKSGLTYPHNHVYYVYCNV 606 L+++ NY ++ V +L VG FSI + V ++F Y + R+ + Y ++ + ++ Sbjct: 47 LHMRTNYFLVSLAVADLLVGAFSI-PMYVYDIFTY-LESRRSRLHTIYNAIDIFTSFASI 104 Query: 607 FKIL*ILIQNRPIHSFTHR 663 F ++ I ++ +F H+ Sbjct: 105 FALVLIALERAYSVNFPHK 123 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +3 Query: 270 VNVPTLVWSSSIRVNFYAIENVKKLALSTQLT 365 V PTL SS + FY EN KKL +ST++T Sbjct: 107 VYAPTLTSSSDAKDAFYMWEN-KKLTISTKIT 137 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,032,133 Number of Sequences: 59808 Number of extensions: 398389 Number of successful extensions: 825 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -