BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10406 (813 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 23 3.4 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 23 4.4 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 23.0 bits (47), Expect = 3.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 331 TLRNSH*AHS*RTRSTNSQFLALQKRFASHCWLNI 435 TLR RT T Q L+L+K+F +L I Sbjct: 2 TLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLTI 36 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 22.6 bits (46), Expect = 4.4 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 298 RVFELTFTLSRTLRNSH*AHS*RTRSTNSQFLALQKRFASHCW 426 R FEL + T H+ RTR N ++ AL+ + W Sbjct: 25 RKFELGRPAANTKLGPQRIHTVRTRGGNKKYRALRLDTGNFSW 67 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,092 Number of Sequences: 438 Number of extensions: 4237 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -