BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10404 (565 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 142 1e-34 SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 129 2e-30 SB_33690| Best HMM Match : Fer4 (HMM E-Value=2.1) 32 0.37 SB_3221| Best HMM Match : rve (HMM E-Value=3) 29 2.0 SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) 28 4.6 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) 28 4.6 SB_32242| Best HMM Match : Pam16 (HMM E-Value=7.4e-20) 27 8.0 SB_33607| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 27 8.0 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 142 bits (345), Expect = 1e-34 Identities = 65/78 (83%), Positives = 72/78 (92%) Frame = +1 Query: 28 KPRGIRTARKHVNHRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQP 207 KPRG+RTARK +HRR+Q+W DK +KKAH+GT KANPFGGASHAKGIVLEKVGVEAKQP Sbjct: 2 KPRGLRTARKLRSHRRDQKWHDKAYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQP 61 Query: 208 NSAIRKCVRVQLIKNGRK 261 NSAIRKCVRVQLIKNG+K Sbjct: 62 NSAIRKCVRVQLIKNGKK 79 Score = 82.2 bits (194), Expect = 3e-16 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = +3 Query: 255 KKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGV 374 KK+TAFVP DGCLN+IEENDEVL++GFGR+GHAVGDIPG+ Sbjct: 78 KKITAFVPNDGCLNYIEENDEVLISGFGRRGHAVGDIPGI 117 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 129 bits (311), Expect = 2e-30 Identities = 58/65 (89%), Positives = 64/65 (98%) Frame = +3 Query: 255 KKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKK 434 KK+TAFVP DGCLN+IEENDEVL++GFGR+GHAVGDIPGVRFKVVKVANVSLLAL+KEKK Sbjct: 79 KKITAFVPNDGCLNYIEENDEVLISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKK 138 Query: 435 ERPRS 449 ERPRS Sbjct: 139 ERPRS 143 Score = 54.0 bits (124), Expect = 8e-08 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 178 EKVGVEAKQPNSAIRKCVRVQLIKNGRK 261 ++ GVEAKQPNSAIRKCVRVQLIKNG+K Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKK 80 >SB_33690| Best HMM Match : Fer4 (HMM E-Value=2.1) Length = 488 Score = 31.9 bits (69), Expect = 0.37 Identities = 25/79 (31%), Positives = 31/79 (39%), Gaps = 5/79 (6%) Frame = -3 Query: 245 MSCTRTHLRMAELGCLASTPTFSR-----TMPFA*DAPPKGLAFHFVPMWAFLNSLSAHR 81 M C + E+ C PT R T DA P GL H M L+ + R Sbjct: 58 MPCQLDYPNYREMPCQLDCPTTERCPANWTTQLQRDALPTGLPKHR-EMPCQLDYPTTER 116 Query: 80 CSRRWFTCLRAVRIPRGLP 24 C W T L+ +P GLP Sbjct: 117 CPANWTTQLQRDALPTGLP 135 Score = 29.1 bits (62), Expect = 2.6 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = -3 Query: 212 ELGCLASTPTFSR-----TMPFA*DAPPKGLAFHFVPMWAFLNSLSAHRCSRRWFTCLRA 48 E+ C PT R T DA P GL ++ M L+ + RC W T L+ Sbjct: 139 EMPCQLDYPTTERCPANWTTQLQRDALPTGLP-NYREMSCQLDYPTTERCPANWTTQLQR 197 Query: 47 VRIPRGLP 24 +P GLP Sbjct: 198 DTLPTGLP 205 Score = 28.7 bits (61), Expect = 3.5 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = -3 Query: 212 ELGCLASTPTFSR-----TMPFA*DAPPKGLAFHFVPMWAFLNSLSAHRCSRRWFTCLRA 48 E+ C PT R T DA P GL ++ M L+ + RC W T L+ Sbjct: 104 EMPCQLDYPTTERCPANWTTQLQRDALPTGLP-NYREMPCQLDYPTTERCPANWTTQLQR 162 Query: 47 VRIPRGLP 24 +P GLP Sbjct: 163 DALPTGLP 170 >SB_3221| Best HMM Match : rve (HMM E-Value=3) Length = 324 Score = 29.5 bits (63), Expect = 2.0 Identities = 23/70 (32%), Positives = 34/70 (48%) Frame = -1 Query: 472 SLITMYTYDLGRSFFSL*RARRDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFSSMWF 293 S T TYDL SF+S+ + + LAT +K++P + + L+P A S S Sbjct: 9 SFDTFPTYDLA-SFYSVLCSGDEQLATIKLMKKSPSLFQKSHTLKPR-ANCASIASETLA 66 Query: 292 RQPSRGTNAV 263 +Q R N V Sbjct: 67 QQCWRSLNTV 76 >SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 108 SPHGYEMEG*PFRWCISRKGHRPRESWCRS*AA 206 S HG MEG P W +S G P+ S C S +A Sbjct: 85 SQHGTRMEGVPVCWYVSVWGLSPQVSQCDSVSA 117 >SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) Length = 623 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 415 LSTKRKRSDQDHRCTL**VTCCREARCL*VHKCKILVHNKYCV 543 +S+KR RS+ + C V CC E V KC V K CV Sbjct: 1 MSSKRTRSESSNLC----VVCCEEIEFSAVGKCDHPVCYKCCV 39 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -2 Query: 288 NRHGGRMRSLS--SVLNELYTDAFADGRVGLLSFYTNFLEDDALCVRCTTE-RVSLPFRT 118 +R+GGRM+SL+ S N + D + + + + ED++ + +T + LP+RT Sbjct: 1851 SRNGGRMKSLANRSGRNGVIRDLLGSQALDTAASFESLTEDESAAITGSTVCSIPLPYRT 1910 >SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 415 LSTKRKRSDQDHRCTL**VTCCREARCL*VHKCKILVHNKYCV 543 +S+KR RS+ + C V CC E V KC V K CV Sbjct: 1 MSSKRTRSESSNLC----VVCCEEIEFSAVGKCDHPVCYKCCV 39 >SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) Length = 943 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -3 Query: 176 RTMPFA*D-APPKGLAFHFVPMW-AFLN-SLSAHR 81 R +PF+ APPKG F VP+W +F N S+ HR Sbjct: 902 RKVPFSSVLAPPKGYRFLIVPLWRSFSNRSVFGHR 936 >SB_32242| Best HMM Match : Pam16 (HMM E-Value=7.4e-20) Length = 255 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 68 TVVNSDGRTKNSRKPTWVRNGRLTLSVVHLT 160 T V R N++KP +R+GR+T+S+ +T Sbjct: 103 THVQFHHRDTNTKKPVHLRDGRVTVSLAAMT 133 >SB_33607| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 256 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 100 ILCPPIAVHDGGSRAYAPFV 41 ++ PP + DG SRA+APF+ Sbjct: 215 LIKPPSTIVDGRSRAHAPFI 234 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,070,588 Number of Sequences: 59808 Number of extensions: 435030 Number of successful extensions: 941 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -