BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10404 (565 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B) ribo... 124 3e-29 At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) simi... 124 3e-29 At5g50790.1 68418.m06292 nodulin MtN3 family protein similar to ... 29 2.8 At4g05280.1 68417.m00799 Ulp1 protease family protein contains P... 28 5.0 At1g32960.1 68414.m04059 subtilase family protein contains simil... 28 5.0 At1g32940.1 68414.m04057 subtilase family protein contains simil... 28 5.0 At1g28470.1 68414.m03501 no apical meristem (NAM) family protein... 27 6.5 At3g52200.1 68416.m05733 dihydrolipoamide S-acetyltransferase, p... 27 8.7 At2g14770.2 68415.m01669 Ulp1 protease family protein similar to... 27 8.7 At2g14770.1 68415.m01668 Ulp1 protease family protein similar to... 27 8.7 At1g34740.1 68414.m04319 Ulp1 protease family protein contains P... 27 8.7 >At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B) ribosomal protein S23, Fragaria x ananassa, PIR:S56673 Length = 142 Score = 124 bits (300), Expect = 3e-29 Identities = 56/65 (86%), Positives = 62/65 (95%) Frame = +3 Query: 255 KKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKK 434 KK+ AFVP DGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKK Sbjct: 78 KKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKK 137 Query: 435 ERPRS 449 E+PRS Sbjct: 138 EKPRS 142 Score = 122 bits (293), Expect = 2e-28 Identities = 55/80 (68%), Positives = 65/80 (81%) Frame = +1 Query: 22 MGKPRGIRTARKHVNHRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAK 201 MGK RG+ RK R QRWADK++KK+H+G +WK PF G+SHAKGIVLEK+G+EAK Sbjct: 1 MGKTRGMGAGRKLKRLRINQRWADKQYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAK 59 Query: 202 QPNSAIRKCVRVQLIKNGRK 261 QPNSAIRKC RVQLIKNG+K Sbjct: 60 QPNSAIRKCARVQLIKNGKK 79 >At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) similar to 40S ribosomal protein S23 (S12) GB:P46297 from [Fragaria x ananassa] Length = 142 Score = 124 bits (300), Expect = 3e-29 Identities = 56/65 (86%), Positives = 62/65 (95%) Frame = +3 Query: 255 KKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKK 434 KK+ AFVP DGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKK Sbjct: 78 KKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKK 137 Query: 435 ERPRS 449 E+PRS Sbjct: 138 EKPRS 142 Score = 113 bits (271), Expect = 1e-25 Identities = 53/80 (66%), Positives = 62/80 (77%) Frame = +1 Query: 22 MGKPRGIRTARKHVNHRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAK 201 MGK RG+ RK R QRWADK +KK++ G +WK PF +SHAKGIVLEK+G+EAK Sbjct: 1 MGKTRGMGAGRKLKQLRITQRWADKHYKKSNRGNEWK-KPFACSSHAKGIVLEKIGIEAK 59 Query: 202 QPNSAIRKCVRVQLIKNGRK 261 QPNSAIRKC RVQLIKNG+K Sbjct: 60 QPNSAIRKCARVQLIKNGKK 79 >At5g50790.1 68418.m06292 nodulin MtN3 family protein similar to MtN3 GI:1619602 (root nodule development) from [Medicago truncatula] Length = 289 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 384 VVKVANVSLLALYKEKKERPRS*VYIVISDLLSGSALFI 500 VV++ +SL Y KKE+ + +++ D+L A+F+ Sbjct: 80 VVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFV 118 >At4g05280.1 68417.m00799 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At1g25886, At4g03300 Length = 1312 Score = 27.9 bits (59), Expect = 5.0 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 249 ERKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVV-KVANVS 407 E KK + VP+ + E D+V GF K V D+P + +VV + NVS Sbjct: 820 EEKKSSPKVPKKVKNQLVYEQDDVHPHGFKAKTVLVPDVPNQQIEVVIRAENVS 873 >At1g32960.1 68414.m04059 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 [Oryza sativa] Length = 777 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 85 WADKEFKKAHMGTKWKANPFGGASHAKG 168 W+ F+ A + T W+ +PFG A+G Sbjct: 575 WSPAAFRSAIVTTAWRTDPFGEQIFAEG 602 >At1g32940.1 68414.m04057 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 from [Oryza sativa] Length = 774 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 85 WADKEFKKAHMGTKWKANPFGGASHAKG 168 W+ F+ A + T W+ +PFG A+G Sbjct: 572 WSPAAFRSAIVTTAWRTDPFGEQIFAEG 599 >At1g28470.1 68414.m03501 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; similar to NAM protein GI:6066594 from [Petunia hybrida] Length = 314 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -2 Query: 306 LRCGLGNRHGGRMRSLSSVLNELYTDAFADGRVGLLSF 193 ++ G G HGG+ + V+ EL DG LSF Sbjct: 263 IQAGFGYEHGGKSEETTQVIRELVVRE-GDGSCSFLSF 299 >At3g52200.1 68416.m05733 dihydrolipoamide S-acetyltransferase, putative similar to dihydrolipoamide acetyltransferase (E2) subunit of PDC [Arabidopsis thaliana] GI:559395; contains Pfam profiles PF00198: 2-oxo acid dehydrogenases acyltransferase (catalytic domain), PF00364: Biotin-requiring enzyme, PF02817: e3 binding domain; supporting cDNA gi|5881964|gb|AF066080.1|AF066080 Length = 637 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 130 KANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGRK*PH 270 K P +S +K V + PNS IRK + +L+++ +K PH Sbjct: 386 KETPSKSSSTSKPSVTQSDNNYEDFPNSQIRKIIAKRLLESKQKIPH 432 >At2g14770.2 68415.m01669 Ulp1 protease family protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1158 Score = 27.1 bits (57), Expect = 8.7 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 249 ERKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVV-KVANVS 407 E KK + VP+ + E D+ GF K V D+P + +VV + NVS Sbjct: 868 EEKKSSPKVPKKVKKQLVYEQDDAHPHGFKAKTVLVPDVPAQQIEVVIRAGNVS 921 >At2g14770.1 68415.m01668 Ulp1 protease family protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1139 Score = 27.1 bits (57), Expect = 8.7 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 249 ERKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVV-KVANVS 407 E KK + VP+ + E D+ GF K V D+P + +VV + NVS Sbjct: 849 EEKKSSPKVPKKVKKQLVYEQDDAHPHGFKAKTVLVPDVPAQQIEVVIRAGNVS 902 >At1g34740.1 68414.m04319 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1383 Score = 27.1 bits (57), Expect = 8.7 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 249 ERKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVV-KVANVS 407 E KK + VP+ + E D+ GF K V D+P + +VV + NVS Sbjct: 820 EEKKSSPKVPKKVKKQLVYEQDDAHPHGFKAKTVLVPDVPAQQIEVVIRAGNVS 873 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,040,345 Number of Sequences: 28952 Number of extensions: 283749 Number of successful extensions: 712 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1082538160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -