BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10403 (796 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21109| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_3124| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_21109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.3 bits (60), Expect = 7.6 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +3 Query: 3 VLVLYDLCATLFIL*NVFAQFRIIQIHENVHRSKHITFI-IYCSEKTRLRF 152 +++LY L AT+ L N+F F I+Q H V R + F+ + S+ T L F Sbjct: 16 LIILYALIATIGFLGNLFVCFIILQ-HRPVRRPMNWLFLNLAISDSTILVF 65 >SB_3124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = -1 Query: 487 EEGYVIALSKHRGVEL-IPKPKKKEIVVF---APRSQC 386 E+GY ++L KH+ V + + PK KE+VV P S C Sbjct: 57 EKGYPLSLRKHKEVHVPVVYPKCKELVVILYDQPLSSC 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,708,557 Number of Sequences: 59808 Number of extensions: 384452 Number of successful extensions: 746 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -