BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10403 (796 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77800.1 68414.m09059 PHD finger family protein contains Pfam... 29 4.7 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 28 6.2 >At1g77800.1 68414.m09059 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1423 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 Query: 464 QQTPWSGAHSKAKKKGNCCIC 402 Q P G S AKK NCC+C Sbjct: 1104 QINPVQGMESLAKKTDNCCVC 1124 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 479 ICHSAQQTPWSGAHSKAKKKGNCCICTALPMRRATNRS 366 +C S + PWSG A K + CT+ P+R TN S Sbjct: 15 VCSSFKSKPWSGRLITAVKSVS---CTSKPVRGLTNYS 49 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,410,797 Number of Sequences: 28952 Number of extensions: 271126 Number of successful extensions: 618 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -