BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10402 (773 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60870.1 68414.m06852 expressed protein 31 0.85 At1g75400.1 68414.m08759 expressed protein 28 6.0 >At1g60870.1 68414.m06852 expressed protein Length = 147 Score = 31.1 bits (67), Expect = 0.85 Identities = 21/52 (40%), Positives = 25/52 (48%) Frame = -1 Query: 359 ETSTKPPYDKRSGTLSSVAARVSTKRHTKATEG*QLHLGVASQRSSRPTAAG 204 E K +R+G L AA V+ KRH A G AS RS+ TAAG Sbjct: 94 ELEEKAETARRTGNLMEKAATVAAKRHIAAAMG----SAAASMRSAWKTAAG 141 >At1g75400.1 68414.m08759 expressed protein Length = 455 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -2 Query: 373 PCINAKLAPSHRTINEAARSAVLPLVSPLNAIQKLQKANSFTLVLPAN 230 P A+ +P H+ + + S +L L SP+N + +SF L +N Sbjct: 169 PSRRARRSPGHQLFRQVSDSQILGLKSPINNYSISEGRSSFVLSTCSN 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,243,192 Number of Sequences: 28952 Number of extensions: 319102 Number of successful extensions: 717 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -