BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10400 (382 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 25 0.23 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 25 0.23 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 1.6 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 21 4.9 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 21 4.9 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 4.9 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 25.4 bits (53), Expect = 0.23 Identities = 19/52 (36%), Positives = 31/52 (59%) Frame = +3 Query: 102 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTS 257 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T V+ S Sbjct: 36 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMTTNLWVEQS 84 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 25.4 bits (53), Expect = 0.23 Identities = 19/52 (36%), Positives = 31/52 (59%) Frame = +3 Query: 102 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTS 257 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T V+ S Sbjct: 36 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMTTNLWVEQS 84 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.6 bits (46), Expect = 1.6 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +3 Query: 102 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTS 257 L S Y+ ++ +V + + +++KL SQLI V+L KNQ T V+ S Sbjct: 32 LLSNYNKLVRPVVNVTDAL--TVKIKLKLSQLIDVNL-KNQIMTTNLWVEQS 80 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 308 RGTRRSLRVPLASCIQTGGV 249 R T ++LR+PL + GG+ Sbjct: 240 RPTDKALRLPLQDVYKIGGI 259 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 308 RGTRRSLRVPLASCIQTGGV 249 R T ++LR+PL + GG+ Sbjct: 183 RPTDKALRLPLQDVYKIGGI 202 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 308 RGTRRSLRVPLASCIQTGGV 249 R T ++LR+PL + GG+ Sbjct: 240 RPTDKALRLPLQDVYKIGGI 259 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,977 Number of Sequences: 438 Number of extensions: 1541 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9300375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -