BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10397 (845 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 3.8 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 5.1 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.6 bits (51), Expect = 3.8 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 194 CSRSIYQNN*LTQ*LREYQENSHCPGQRD-HHDCRVLR 84 C + Y N L +QE C G D HH+CR L+ Sbjct: 672 CPQDFYANEETRICLPCHQECRGCHGLGDDHHECRNLK 709 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 5.1 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -2 Query: 343 TSPMFHRVSPFPLFFQQKDVKVS 275 T+ + ++S FP+F + +VKVS Sbjct: 890 TTKLIPKISSFPIFTRSGEVKVS 912 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 845,081 Number of Sequences: 2352 Number of extensions: 17225 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89718867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -