Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10397
         (845 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              26   0.38 

>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 26.2 bits (55), Expect = 0.38
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = -2

Query: 652 VLNIKGLTVCSGRGVNLKFPLCISNKPQC--LGSASPAAKEVATVLPGCTQKSCLSLFYF 479
           V  +KG+    GR +N+      +++P    +   S     +  V+P  T K+ + L+Y 
Sbjct: 541 VCGVKGIPCSWGRAINVANRYVYASQPDKDRVLVISEIQMVIVDVIP--TDKNPVQLWYV 598

Query: 478 PSLDK 464
           PSLD+
Sbjct: 599 PSLDQ 603


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 224,864
Number of Sequences: 438
Number of extensions: 4826
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27188448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)