Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10395
         (832 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_05_1291 - 35516715-35517251,35517339-35518185,35518480-355190...    32   0.64 

>02_05_1291 -
           35516715-35517251,35517339-35518185,35518480-35519009,
           35519092-35519529
          Length = 783

 Score = 31.9 bits (69), Expect = 0.64
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = +1

Query: 454 PHAFYERGVALLTSTALN*LYITSDTPTLRFRNCNL*LISPLFNGCYYTYKASSSITVSI 633
           PH  + RGV L T  A+    ++  T  LR    NL +    F   YY Y A+S   + I
Sbjct: 317 PHIIHFRGVILSTPDAVRTCLLSKRTIHLRHLLSNLDISVDSFVPHYYGYYATSKDAIQI 376

Query: 634 KKN 642
           + N
Sbjct: 377 QMN 379


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,923,213
Number of Sequences: 37544
Number of extensions: 422747
Number of successful extensions: 1046
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1014
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1046
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2291695380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)