BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10385 (811 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0026 - 351737-353443 29 5.8 03_06_0190 + 32219878-32220465,32220551-32220652,32220730-322207... 28 7.6 >10_01_0026 - 351737-353443 Length = 568 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 39 GAGPRACEWWLPHRVALLIASPSPLLHIPC*SRPLGRSIQS 161 G G R +W HR+AL A LH C R + R I++ Sbjct: 323 GNGDRVLDWSARHRIALGSAKGLAYLHEDCHPRIIHRDIKA 363 >03_06_0190 + 32219878-32220465,32220551-32220652,32220730-32220795, 32220977-32221042,32221135-32221422,32222178-32222276, 32222821-32222914,32223923-32223975 Length = 451 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -1 Query: 121 MWRSGDGDAIRSATRCGSHHSHALGP-APLACARGPLVS 8 +WRS GDA +A G HA P P AR P+ S Sbjct: 71 LWRSVTGDAFPAAAAAGPSSHHAPPPDLPPPAARPPMRS 109 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,331,449 Number of Sequences: 37544 Number of extensions: 359764 Number of successful extensions: 957 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 957 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2209429392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -