BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31056 (661 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U63542-1|AAC51145.1| 252|Homo sapiens FAP protein protein. 30 6.4 U14971-1|AAA85659.1| 194|Homo sapiens ribosomal protein S9 prot... 30 6.4 AY392858-1|AAS85801.1| 122|Homo sapiens immunoglobulin heavy ch... 30 6.4 >U63542-1|AAC51145.1| 252|Homo sapiens FAP protein protein. Length = 252 Score = 30.3 bits (65), Expect = 6.4 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 462 NRPPNPYKDKFKPSYPLHHRISQSQFTL 545 N P P+ PSYPLH R+ Q + TL Sbjct: 123 NTKPKPFCCDHPPSYPLHFRLYQMEKTL 150 >U14971-1|AAA85659.1| 194|Homo sapiens ribosomal protein S9 protein. Length = 194 Score = 30.3 bits (65), Expect = 6.4 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +1 Query: 454 RLLIDHQIHIRINLNLV-IPSITESANPSSHSAAAITAPGGLVRPGGTRPNRSKPQKASF 630 R+LI Q HIR+ +V IPS + H ++ +P G+ RPG + +K + Sbjct: 127 RVLI-RQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPTGVGRPGRVKRKNAKKGQGGA 185 Query: 631 G 633 G Sbjct: 186 G 186 >AY392858-1|AAS85801.1| 122|Homo sapiens immunoglobulin heavy chain protein. Length = 122 Score = 30.3 bits (65), Expect = 6.4 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +1 Query: 91 IFNVLNFIWKMQYLVQLVVAFLLTTQASSDNSTLSEDT----CITEHGLWG 231 +FN+ N+ K Q V L T +S SEDT C T G WG Sbjct: 50 VFNITNYAQKFQGRVTLTADESTNTAYMELSSLRSEDTAVYYCATREGFWG 100 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,507,722 Number of Sequences: 237096 Number of extensions: 2263815 Number of successful extensions: 14096 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14088 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7422585720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -