BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31053 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.47 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 23 3.3 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 22 5.8 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 25.4 bits (53), Expect = 0.47 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 357 GIQQMLILRC*RQRTSFFFFCEDFVELVHL 268 GI L+ +C R ++F+C VHL Sbjct: 41 GILDSLVFKCYNLRRIYYFYCVSITFNVHL 70 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 322 PSTPEDQHLLDA 357 P +PED+ LLDA Sbjct: 234 PKSPEDEELLDA 245 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.8 bits (44), Expect = 5.8 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +3 Query: 141 PSSRD*NKRRCGKWNLILDPKACPPM-DCDAGKDG-IPMREPC 263 P SRD C K + DP C C A G +P+ + C Sbjct: 412 PPSRDLTTTLCTKAGYVRDPDDCSIFYYCLAYNGGFVPLEQRC 454 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,511 Number of Sequences: 336 Number of extensions: 4031 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -