BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31053 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 1.8 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 25 2.4 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 4.2 AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CY... 23 7.3 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 9.7 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 9.7 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 25.4 bits (53), Expect = 1.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 431 PNRPRNSFAKYGRRRGTCAISDICHV 508 P+ PR S A+YG RRG S I V Sbjct: 532 PDSPRLSDAQYGFRRGRSTFSAIQRV 557 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 25.0 bits (52), Expect = 2.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 431 PNRPRNSFAKYGRRRGTCAISDI 499 P+ P+ S A+YG RRG IS I Sbjct: 537 PDSPQLSDAQYGFRRGRSTISAI 559 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 24.2 bits (50), Expect = 4.2 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 391 ITRQLSKLQPFRHPTDVDPPVLKA 320 I + L +LQP R D DP VLK+ Sbjct: 363 IRKVLYRLQPSRTAQDRDPVVLKS 386 >AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CYP4J5 protein. Length = 153 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 720 ITLSWQFEISDRRTRPESRFAT 655 +TLSW+ EI R + S+ AT Sbjct: 22 LTLSWELEIQTRLHQELSQLAT 43 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 23.0 bits (47), Expect = 9.7 Identities = 13/59 (22%), Positives = 28/59 (47%) Frame = +1 Query: 310 GCPLPSTPEDQHLLDAEMAEVLKAGVLSDEIDLGALAHNAAEQAEEFVRKVWEASWNVC 486 G P+ Q L + + +L+ + + + G L + E + F++ + +A W+VC Sbjct: 356 GFPMIDAAMRQLLAEGWLHHILR-NITATFLTRGGLWLSWEEGLQHFLKYLLDADWSVC 413 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 9.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 422 ITPPNRPRNSFAKYGRRRGTCAISDICHV 508 I + P+ S A+YG RRG IS I V Sbjct: 590 IEQQDSPQLSDAQYGFRRGRSTISAIQRV 618 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 817,508 Number of Sequences: 2352 Number of extensions: 18221 Number of successful extensions: 50 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -