BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31046 (464 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 4.9 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 6.5 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 8.6 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 4.9 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +2 Query: 320 SAM*SAPPPEFHSATSNCQNTSMMITSRRIRSASNVQSNAKRVMTSLP 463 +A+ S PPP F + + + S ++++ R + + +A M +P Sbjct: 374 TALMSQPPPNFGVSQVSPVSMSALVSAVRSPAGGQLPPSAGAPMPPIP 421 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.0 bits (42), Expect = 6.5 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +1 Query: 13 QEADCCCKADWR*EEWG--NQNST 78 Q+AD CC W + G N++ST Sbjct: 83 QDADFCCGMRWPGDATGLSNRSST 106 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = +1 Query: 100 LPHSGENPCFIWWPSIQQACTQDPTQ 177 +P +NP W AC+ P Q Sbjct: 373 IPEPSKNPAMGHWQMSCVACSPPPRQ 398 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,772 Number of Sequences: 438 Number of extensions: 2683 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12436029 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -