BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31045 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 8.6 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 8.6 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 8.6 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 8.6 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.6 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 76 GWHDWGEKSGPLATP 32 GW+DW E+ P TP Sbjct: 174 GWNDWPEELEP-GTP 187 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 76 GWHDWGEKSGPLATP 32 GW+DW E+ P TP Sbjct: 174 GWNDWPEELEP-GTP 187 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 132 VGCQTLDKFCPNPQGTIMGVGMIGVKNLA 46 + + LDK+ P P G + M ++LA Sbjct: 131 INWEYLDKYKPTPLGAVATEKMFVARHLA 159 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 76 GWHDWGEKSGPLATP 32 GW+DW E+ P TP Sbjct: 174 GWNDWPEELEP-GTP 187 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +2 Query: 335 YVLLSDLPSRSGIWKARRWLKSSGLKSLTKR 427 Y L ++ WK W K KS +K+ Sbjct: 409 YYLKPSYDAQEPAWKTHVWKKGRDKKSTSKK 439 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,189 Number of Sequences: 438 Number of extensions: 5337 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -