BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31040 (430 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22300.2 68414.m02789 14-3-3 protein GF14 epsilon (GRF10) ide... 75 2e-14 At1g22300.1 68414.m02788 14-3-3 protein GF14 epsilon (GRF10) ide... 75 2e-14 At1g34760.1 68414.m04323 14-3-3 protein GF14 omicron (GRF11) ide... 70 8e-13 At1g26480.1 68414.m03229 14-3-3 protein GF14 iota (GRF12) identi... 69 1e-12 At2g42590.1 68415.m05270 14-3-3 protein GF14 mu (GRF9) identical... 69 2e-12 At5g65430.1 68418.m08228 14-3-3 protein GF14 kappa (GRF8) identi... 68 3e-12 At5g10450.1 68418.m01211 14-3-3 protein GF14 lambda (GRF6) (AFT1... 68 3e-12 At1g78300.1 68414.m09125 14-3-3 protein GF14 omega (GRF2) identi... 68 3e-12 At4g09000.1 68417.m01487 14-3-3-like protein GF14 chi / general... 67 4e-12 At1g35160.1 68414.m04360 14-3-3 protein GF14 phi (GRF4) identica... 67 4e-12 At5g38480.1 68418.m04651 14-3-3 protein GF14 psi (GRF3) (RCI1) i... 67 5e-12 At5g65430.2 68418.m08229 14-3-3 protein GF14 kappa (GRF8) identi... 66 7e-12 At1g22300.3 68414.m02790 14-3-3 protein GF14 epsilon (GRF10) ide... 66 7e-12 At5g16050.1 68418.m01876 14-3-3 protein GF14 upsilon (GRF5) iden... 64 4e-11 At3g02520.1 68416.m00240 14-3-3 protein GF14 nu (GRF7) identical... 62 1e-10 At2g10450.1 68415.m01098 14-3-3 protein, putative / grf15, putat... 54 5e-08 At1g78220.1 68414.m09115 14-3-3 protein GF14 pi (GRF13) similar ... 31 0.33 At2g22310.1 68415.m02647 ubiquitin-specific protease 4 (UBP4) id... 29 1.0 At4g39910.1 68417.m05653 ubiquitin-specific protease 3 (UBP3) id... 29 1.3 At2g47090.1 68415.m05882 zinc finger (C2H2 type) family protein ... 28 2.3 At5g52530.2 68418.m06518 dentin sialophosphoprotein-related cont... 28 3.1 At5g52530.1 68418.m06517 dentin sialophosphoprotein-related cont... 28 3.1 At4g35030.1 68417.m04969 protein kinase family protein contains ... 27 7.1 At1g65690.1 68414.m07456 harpin-induced protein-related / HIN1-r... 27 7.1 >At1g22300.2 68414.m02789 14-3-3 protein GF14 epsilon (GRF10) identical to 14-3-3 protein GF14 epsilon GI:5802798, SP:P48347 from [Arabidopsis thaliana] Length = 254 Score = 75.4 bits (177), Expect = 2e-14 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPAEGGD 132 AELD+LNE+SYKDSTLIMQLLRDNLTLWTSD +GDE +G D Sbjct: 205 AELDSLNEESYKDSTLIMQLLRDNLTLWTSDLNEEGDERTKGAD 248 >At1g22300.1 68414.m02788 14-3-3 protein GF14 epsilon (GRF10) identical to 14-3-3 protein GF14 epsilon GI:5802798, SP:P48347 from [Arabidopsis thaliana] Length = 254 Score = 75.4 bits (177), Expect = 2e-14 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPAEGGD 132 AELD+LNE+SYKDSTLIMQLLRDNLTLWTSD +GDE +G D Sbjct: 205 AELDSLNEESYKDSTLIMQLLRDNLTLWTSDLNEEGDERTKGAD 248 >At1g34760.1 68414.m04323 14-3-3 protein GF14 omicron (GRF11) identical to SP:Q9S9Z8, 14-3-3-like protein GF14 omicron (General regulatory factor 11){Arabidopsis thaliana} Length = 255 Score = 69.7 bits (163), Expect = 8e-13 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPAEG 126 AELD+LNEDSYKDSTLIMQLLRDNLTLWTSD + +G E ++G Sbjct: 205 AELDSLNEDSYKDSTLIMQLLRDNLTLWTSDLE-EGGEQSKG 245 >At1g26480.1 68414.m03229 14-3-3 protein GF14 iota (GRF12) identical to 14-3-3 protein GF14iota GI:12963453 from [Arabidopsis thaliana] Length = 268 Score = 68.9 bits (161), Expect = 1e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDE 114 AELDTL+E+SYKDSTLIMQLLRDNLTLWTSD DG E Sbjct: 210 AELDTLSEESYKDSTLIMQLLRDNLTLWTSDLPEDGGE 247 >At2g42590.1 68415.m05270 14-3-3 protein GF14 mu (GRF9) identical to GF14 mu GI:3551052, SP:Q96299 from [Arabidopsis thaliana] Length = 263 Score = 68.5 bits (160), Expect = 2e-12 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPA 120 +ELDTLNE+SYKDSTLIMQLLRDNLTLWTSD +G + A Sbjct: 207 SELDTLNEESYKDSTLIMQLLRDNLTLWTSDISEEGGDDA 246 >At5g65430.1 68418.m08228 14-3-3 protein GF14 kappa (GRF8) identical to 14-3-3 protein GF14 kappa GI:5802794, SP:P48348 from [Arabidopsis thaliana] Length = 248 Score = 67.7 bits (158), Expect = 3e-12 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDE 114 AELDTL E+SYKDSTLIMQLLRDNLTLWTSD Q DE Sbjct: 210 AELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDE 247 >At5g10450.1 68418.m01211 14-3-3 protein GF14 lambda (GRF6) (AFT1) identical to 14-3-3 GF14lambda GI:1345595 from [Arabidopsis thaliana] Length = 248 Score = 67.7 bits (158), Expect = 3e-12 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDE 114 AELDTL E+SYKDSTLIMQLLRDNLTLWTSD Q DE Sbjct: 210 AELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDE 247 >At1g78300.1 68414.m09125 14-3-3 protein GF14 omega (GRF2) identical to GF14omega isoform GI:487791 from [Arabidopsis thaliana] Length = 259 Score = 67.7 bits (158), Expect = 3e-12 Identities = 34/42 (80%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGD-GDEPAE 123 AELDTL E+SYKDSTLIMQLLRDNLTLWTSD Q D DE E Sbjct: 207 AELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKE 248 >At4g09000.1 68417.m01487 14-3-3-like protein GF14 chi / general regulatory factor 1 (GRF1) identical to 14-3-3 protein GF14 chi chain GI:1702986, SP:P42643 from [Arabidopsis thaliana] Length = 267 Score = 67.3 bits (157), Expect = 4e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGD 105 AELDTL E+SYKDSTLIMQLLRDNLTLWTSD Q D Sbjct: 212 AELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD 246 >At1g35160.1 68414.m04360 14-3-3 protein GF14 phi (GRF4) identical to GF14 protein phi chain GI:1493805, SP:P46077 from [Arabidopsis thaliana] Length = 267 Score = 67.3 bits (157), Expect = 4e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDE 114 AELDTL E+SYKDSTLIMQLLRDNLTLWTSD Q + E Sbjct: 213 AELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDESPE 250 >At5g38480.1 68418.m04651 14-3-3 protein GF14 psi (GRF3) (RCI1) identical to 14-3-3 protein GF14 psi GI:1168200, SP:P42644 Length = 255 Score = 66.9 bits (156), Expect = 5e-12 Identities = 34/42 (80%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSD-TQGDGDEPAE 123 AELDTL E+SYKDSTLIMQLLRDNLTLWTSD T GDE E Sbjct: 206 AELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKE 247 >At5g65430.2 68418.m08229 14-3-3 protein GF14 kappa (GRF8) identical to 14-3-3 protein GF14 kappa GI:5802794, SP:P48348 from [Arabidopsis thaliana] Length = 246 Score = 66.5 bits (155), Expect = 7e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGD 105 AELDTL E+SYKDSTLIMQLLRDNLTLWTSD Q D Sbjct: 210 AELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQMD 244 >At1g22300.3 68414.m02790 14-3-3 protein GF14 epsilon (GRF10) identical to 14-3-3 protein GF14 epsilon GI:5802798, SP:P48347 from [Arabidopsis thaliana] Length = 251 Score = 66.5 bits (155), Expect = 7e-12 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDG 108 AELD+LNE+SYKDSTLIMQLLRDNLTLWTSD +G Sbjct: 205 AELDSLNEESYKDSTLIMQLLRDNLTLWTSDLNEEG 240 >At5g16050.1 68418.m01876 14-3-3 protein GF14 upsilon (GRF5) identical to 14-3-3 protein GF14 upsilon GI:2232148 from [Arabidopsis thaliana] Length = 268 Score = 64.1 bits (149), Expect = 4e-11 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGD-GDEPAE 123 +ELDTL E+SYKDSTLIMQLLRDNLTLWTSD + GD+ E Sbjct: 209 SELDTLGEESYKDSTLIMQLLRDNLTLWTSDLNDEAGDDIKE 250 >At3g02520.1 68416.m00240 14-3-3 protein GF14 nu (GRF7) identical to 14-3-3 protein GF14 nu GI:1531631 from [Arabidopsis thaliana] Length = 265 Score = 62.5 bits (145), Expect = 1e-10 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = +1 Query: 1 AELDTLNEDSYKDSTLIMQLLRDNLTLWTSD--TQGDGDEPAE 123 +ELDTL E+SYKDSTLIMQLLRDNLTLW SD + GDE E Sbjct: 207 SELDTLGEESYKDSTLIMQLLRDNLTLWNSDINDEAGGDEIKE 249 >At2g10450.1 68415.m01098 14-3-3 protein, putative / grf15, putative contains similarity to GF14 psi chain GI:166717, SP:P42644 from [Arabidopsis thaliana] Length = 82 Score = 53.6 bits (123), Expect = 5e-08 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +1 Query: 7 LDTLNEDSYKDSTLIMQLLRDNLTLWTSD-TQGDGDEPAE 123 LD L ++ YKDSTLIM++LRDNLT WTSD T GDE E Sbjct: 21 LDALGDELYKDSTLIMKILRDNLTFWTSDMTDEAGDEIKE 60 >At1g78220.1 68414.m09115 14-3-3 protein GF14 pi (GRF13) similar to GF14 epsilon isoform GI:1022778 from [Arabidopsis thaliana]; contains Pfam profile: PF00244 14-3-3 proteins Length = 245 Score = 31.1 bits (67), Expect = 0.33 Identities = 15/36 (41%), Positives = 26/36 (72%) Frame = +1 Query: 4 ELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGD 111 ELD L+++ ++S I+++L+ NL+ WTS GDG+ Sbjct: 207 ELDGLDKNICEESMYIIEMLKYNLSTWTS---GDGN 239 >At2g22310.1 68415.m02647 ubiquitin-specific protease 4 (UBP4) identical to GI:2347100 Length = 365 Score = 29.5 bits (63), Expect = 1.0 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 200 VTFENVVWRGIITEADASLACKNVKSRSQRTLPFRLKLNVVSSLT 334 VT+ + +++GI+T L C+ V +R + L L + SS+T Sbjct: 164 VTWVHKIFQGILTNETRCLRCETVTARDETFLDLSLDIEQNSSIT 208 >At4g39910.1 68417.m05653 ubiquitin-specific protease 3 (UBP3) identical to GI:2347098 Length = 371 Score = 29.1 bits (62), Expect = 1.3 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 200 VTFENVVWRGIITEADASLACKNVKSRSQRTLPFRLKLNVVSSLT 334 VT+ + +++GI+T L C+ V +R + L L + SS+T Sbjct: 169 VTWVHNIFQGILTNETRCLRCETVTARDETFLDLSLDIEQNSSIT 213 >At2g47090.1 68415.m05882 zinc finger (C2H2 type) family protein contains Prosite PS00028: Zinc finger, C2H2 type, domain Length = 745 Score = 28.3 bits (60), Expect = 2.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 198 RFLINTDENKCVCWXECGEILVVAALG 118 RF++N D C+C EC + V ALG Sbjct: 34 RFILN-DRRCCICKTECPVVFVTKALG 59 >At5g52530.2 68418.m06518 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +3 Query: 135 LISRRTXPSTRICSHRCL*ENE*HSRTSSGAVSSPKPTRASL 260 +++ + P T +C+ ++ HSR +SG + +PK T +L Sbjct: 217 IVAPQKHPLTNLCNELADEQSVEHSRVTSGGIIAPKKTCIAL 258 >At5g52530.1 68418.m06517 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +3 Query: 135 LISRRTXPSTRICSHRCL*ENE*HSRTSSGAVSSPKPTRASL 260 +++ + P T +C+ ++ HSR +SG + +PK T +L Sbjct: 217 IVAPQKHPLTNLCNELADEQSVEHSRVTSGGIIAPKKTCIAL 258 >At4g35030.1 68417.m04969 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 321 Score = 26.6 bits (56), Expect = 7.1 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +2 Query: 212 NVVWRGIITEADASLACKNVKSRSQRTLP-FRLKLNVVSSLT 334 N V+RGI+ E +A K +KS S+ + F ++N++SSL+ Sbjct: 116 NEVYRGIL-EDGKGIAVKILKSSSKEAMTNFVHEINIISSLS 156 >At1g65690.1 68414.m07456 harpin-induced protein-related / HIN1-related / harpin-responsive protein-related similar to hin1 homolog (GI:13122296) [Arabidopsis thaliana]; similar to hin1 (GI:22830759) [Nicotiana tabacum]; contains 1 transmembrane domain; Length = 252 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 171 KCVCWXECGEILVVAALGRLVAIALSV*RPK 79 +C C+ C +L+V A+G + I V +PK Sbjct: 64 RCFCYTFCFLLLLVVAVGASIGILYLVFKPK 94 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,103,061 Number of Sequences: 28952 Number of extensions: 117573 Number of successful extensions: 359 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 359 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -