BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31037 (609 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97016-8|AAB52350.2| 779|Caenorhabditis elegans Hypothetical pr... 29 3.4 Z78064-4|CAB01507.1| 235|Caenorhabditis elegans Hypothetical pr... 28 4.5 U40941-5|AAA81710.1| 300|Caenorhabditis elegans Hypothetical pr... 28 6.0 >U97016-8|AAB52350.2| 779|Caenorhabditis elegans Hypothetical protein B0261.1 protein. Length = 779 Score = 28.7 bits (61), Expect = 3.4 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 3/23 (13%) Frame = +3 Query: 462 PPPEP---VEQRLPRIPAVLHPR 521 PPPEP VE+ LP+ P V PR Sbjct: 20 PPPEPAPVVEETLPQAPVVAEPR 42 >Z78064-4|CAB01507.1| 235|Caenorhabditis elegans Hypothetical protein F57B1.7 protein. Length = 235 Score = 28.3 bits (60), Expect = 4.5 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = +1 Query: 409 RVDTLVLLLYRNTSMFTYLPQNQLSKDFLVSLLCXTPETFQDHLHQGPXSS 561 R DTL L +N+ T P NQ+S + L SLL + T L P SS Sbjct: 12 RKDTL-LTFAKNSITSTMFPSNQISLNALNSLLYGSINTSPQPLLSSPTSS 61 >U40941-5|AAA81710.1| 300|Caenorhabditis elegans Hypothetical protein F35C8.5 protein. Length = 300 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 118 WYSPVWLWPMAALNLQWDTATPLP 189 W +W++PMA + L W T LP Sbjct: 98 WNQLLWIYPMALVQLIWVPDTELP 121 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,751,712 Number of Sequences: 27780 Number of extensions: 171048 Number of successful extensions: 597 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1311096392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -