BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31033 (812 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011482-1|AAR99140.1| 263|Drosophila melanogaster RE06553p pro... 29 5.7 AE013599-2756|AAF57647.2| 263|Drosophila melanogaster CG18609-P... 29 5.7 >BT011482-1|AAR99140.1| 263|Drosophila melanogaster RE06553p protein. Length = 263 Score = 29.5 bits (63), Expect = 5.7 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -3 Query: 363 YKLTIYQ*GHIWVANSKFVQITTNAKRY-LFTILYGSINFIQTYYY 229 Y L + + G I++ N K + T K Y LF +LY + F +YY Sbjct: 31 YLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFGMVFYY 76 >AE013599-2756|AAF57647.2| 263|Drosophila melanogaster CG18609-PA protein. Length = 263 Score = 29.5 bits (63), Expect = 5.7 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -3 Query: 363 YKLTIYQ*GHIWVANSKFVQITTNAKRY-LFTILYGSINFIQTYYY 229 Y L + + G I++ N K + T K Y LF +LY + F +YY Sbjct: 31 YLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFGMVFYY 76 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,489,582 Number of Sequences: 53049 Number of extensions: 646153 Number of successful extensions: 943 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 943 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3818998872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -