BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31030 (752 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 43 2e-04 SB_29609| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25444| Best HMM Match : SH2 (HMM E-Value=6.4) 43 2e-04 SB_47163| Best HMM Match : SH2 (HMM E-Value=6.4) 43 2e-04 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 43 2e-04 SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) 42 4e-04 SB_9149| Best HMM Match : Lipase_GDSL (HMM E-Value=0.51) 41 0.001 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) 41 0.001 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 41 0.001 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 40 0.002 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9316| Best HMM Match : SH2 (HMM E-Value=6.4) 40 0.003 SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) 40 0.003 SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) 39 0.005 SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) 38 0.007 SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 38 0.007 SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) 38 0.007 SB_39284| Best HMM Match : WW (HMM E-Value=7.9) 38 0.007 SB_38574| Best HMM Match : WW (HMM E-Value=4.9) 38 0.007 SB_54439| Best HMM Match : SNF (HMM E-Value=0) 38 0.009 SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) 38 0.009 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_5462| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) 38 0.012 SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) 38 0.012 SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) 37 0.015 SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) 37 0.015 SB_16546| Best HMM Match : SH2 (HMM E-Value=6.4) 37 0.015 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 37 0.015 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 37 0.015 SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) 37 0.020 SB_5514| Best HMM Match : TB (HMM E-Value=4.3) 37 0.020 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) 36 0.027 SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) 36 0.027 SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) 36 0.027 SB_27289| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.062 SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.062 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 35 0.062 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.062 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.062 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.062 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 35 0.062 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.062 SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.082 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 35 0.082 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 35 0.082 SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 35 0.082 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 35 0.082 SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.082 SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) 35 0.082 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 35 0.082 SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) 35 0.082 SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 35 0.082 SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.082 SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.082 SB_53921| Best HMM Match : Viral_P18 (HMM E-Value=2.6) 34 0.11 SB_52416| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) 34 0.11 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) 34 0.11 SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) 34 0.11 SB_23599| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) 34 0.11 SB_55213| Best HMM Match : Viral_P18 (HMM E-Value=2.6) 34 0.11 SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) 34 0.11 SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) 34 0.11 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 34 0.11 SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 34 0.14 SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) 34 0.14 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.19 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.19 SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.25 SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) 33 0.25 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 33 0.25 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_4311| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_31881| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 33 0.33 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 33 0.33 SB_1670| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 33 0.33 SB_49069| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 32 0.43 SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) 32 0.43 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 32 0.43 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 32 0.43 SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) 32 0.43 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 32 0.57 SB_6318| Best HMM Match : RVT_1 (HMM E-Value=0.72) 32 0.57 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 31 0.76 SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 31 1.0 SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 31 1.3 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 31 1.3 SB_35414| Best HMM Match : NinE (HMM E-Value=8.4) 31 1.3 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 31 1.3 SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 31 1.3 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 31 1.3 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 31 1.3 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 31 1.3 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 31 1.3 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 31 1.3 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 31 1.3 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 31 1.3 SB_15503| Best HMM Match : DUF217 (HMM E-Value=5.3) 31 1.3 SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) 31 1.3 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.8 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 30 1.8 SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08) 30 1.8 SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) 30 2.3 SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) 30 2.3 SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) 30 2.3 SB_34939| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 29 3.1 SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_7040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) 29 3.1 SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 29 3.1 SB_51188| Best HMM Match : RVT_1 (HMM E-Value=4.5e-24) 29 4.1 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 29 4.1 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 29 4.1 SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) 29 4.1 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.1 SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 29 4.1 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 29 4.1 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 29 4.1 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 29 4.1 SB_1766| Best HMM Match : Nodulin_late (HMM E-Value=7.2) 29 4.1 SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_52705| Best HMM Match : RnaseA (HMM E-Value=1.4) 29 4.1 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 29 4.1 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 29 4.1 SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 29 4.1 SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) 29 4.1 SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_29894| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) 29 5.4 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) 29 5.4 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_17216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_47925| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_42199| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) 28 9.4 SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) Length = 552 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ + W Sbjct: 409 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 468 Query: 208 FVRNVDLHDDLGL 246 + L ++L + Sbjct: 469 DAPSKPLFEELNI 481 >SB_29609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/69 (24%), Positives = 36/69 (52%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWFVRN 219 K+ +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ + W + Sbjct: 66 KKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKWDAPS 125 Query: 220 VDLHDDLGL 246 L ++L + Sbjct: 126 KPLFEELNI 134 >SB_25444| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ + W Sbjct: 109 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 168 Query: 208 FVRNVDLHDDLGL 246 + L ++L + Sbjct: 169 DAPSKPLFEELNI 181 >SB_47163| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 172 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ + W Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 131 Query: 208 FVRNVDLHDDLGL 246 + L ++L + Sbjct: 132 DAPSKPLFEELNI 144 >SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) Length = 309 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ + W Sbjct: 207 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 266 Query: 208 FVRNVDLHDDLGL 246 + L ++L + Sbjct: 267 DAPSKPLFEELNI 279 >SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 323 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ + W Sbjct: 186 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 245 Query: 208 FVRNVDLHDDLGL 246 + L ++L + Sbjct: 246 DSPSKPLFEELNI 258 >SB_9149| Best HMM Match : Lipase_GDSL (HMM E-Value=0.51) Length = 604 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 2/73 (2%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q + R+ + W Sbjct: 436 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKQCARVIIDKKW 495 Query: 208 FVRNVDLHDDLGL 246 L ++L + Sbjct: 496 DAPAKPLFEELNI 508 >SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/73 (24%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + + R R+ + W Sbjct: 204 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGLTKKQHIDYMVKFEKRCARVILDKKW 263 Query: 208 FVRNVDLHDDLGL 246 + L ++L + Sbjct: 264 DAPSKPLFEELNI 276 >SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 228 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ + W Sbjct: 160 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 219 >SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 675 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ + W Sbjct: 605 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 664 >SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) Length = 277 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y I+P++ Y ++V+ + HID + Q R R+ + W Sbjct: 207 LLKRTKKFLSLKARTLFYHALIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 266 >SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ + W Sbjct: 823 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDNKW 882 >SB_9316| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 169 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 2/73 (2%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R+ + W Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKGCARVILDKKW 131 Query: 208 FVRNVDLHDDLGL 246 + L ++L + Sbjct: 132 NAPSKPLLEELNI 144 >SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) Length = 587 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 66 RLYALRVLKKCGLDAKELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 124 >SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS VFA+ D L+++Q R ++A Sbjct: 44 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS VFA+ D L+++Q R ++A Sbjct: 44 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) Length = 599 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 204 KR +S N + +Y++ +R + YASVVFA R D+L+ +Q C LA+ P Sbjct: 463 KRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQK--CTLAIIYP 515 >SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) Length = 172 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 RLY + KR +S N + +Y++ +R + YASVVFA R D+L+ +Q R Sbjct: 7 RLYAIRQLKRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 60 >SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 2/68 (2%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 81 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAF 140 Query: 196 -GAPWFVR 216 G + VR Sbjct: 141 PGRSYVVR 148 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 RLY + KR +S N + +Y++ +R + YASVVFA R D+L+ +Q R Sbjct: 389 RLYAIRQLKRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 442 >SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) Length = 151 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 RLY + KR +S N + +Y++ +R + YASVVFA R D+L+ +Q R Sbjct: 7 RLYAIRQLKRCGVSTDNIIVVYRSLVRSTLKYASVVFADLPRYLSDSLERVQKR 60 >SB_39284| Best HMM Match : WW (HMM E-Value=7.9) Length = 251 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 109 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLFDALENVQRRALKIA 167 >SB_38574| Best HMM Match : WW (HMM E-Value=4.9) Length = 256 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS+ FA+ D L+++Q R ++A Sbjct: 114 RLYALRVLKKCGLDAIELITVYRSPIRSVIEYASIAFANLQNYLSDVLENVQRRVLKIA 172 >SB_54439| Best HMM Match : SNF (HMM E-Value=0) Length = 701 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + I K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 640 RLYALRILKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 698 >SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) Length = 596 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 426 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAF 485 Query: 196 GA 201 A Sbjct: 486 PA 487 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 37.9 bits (84), Expect = 0.009 Identities = 14/55 (25%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +1 Query: 31 MICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRLA 192 ++ KR+++ + + + Y TC+RP++ Y + +F H ++ + L+ +Q R +A Sbjct: 625 VLLKRARVPVSDIIGFYNTCVRPILEYCAPLFHHTIPAYVKEDLEHIQKRALSIA 679 >SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 161 RLYALRVLKKCGLDAIELITVYRSFIRSVIEYASAAFANLPNCLCDDLENVQRRALKIA 219 >SB_5462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 195 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASATFANLPNYLSDALENVQRRTLKIA 253 >SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 181 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 239 >SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 352 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 294 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 347 >SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) Length = 397 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 255 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 313 >SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) Length = 270 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +1 Query: 34 ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 186 + KR+K L + Y + I+P++ Y ++V+ + HID + Q R R Sbjct: 220 LLKRTKKFLSARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMIKFQKRCAR 270 >SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.1 bits (82), Expect = 0.015 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+ +Q R ++A Sbjct: 41 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALEDVQRRALKIA 99 >SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) Length = 208 Score = 37.1 bits (82), Expect = 0.015 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + + +T+Y++ IR V+ YAS FA+ D L+ +Q R ++A Sbjct: 66 RLYALRVLKKCGLDVIELITVYRSLIRSVIEYASEAFANLPNYLSDALEKVQRRALKIA 124 >SB_16546| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 124 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 186 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 124 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 186 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R Sbjct: 176 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 228 >SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 186 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 124 >SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) Length = 754 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 +LY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 557 KLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAF 616 Query: 196 GA 201 A Sbjct: 617 PA 618 >SB_5514| Best HMM Match : TB (HMM E-Value=4.3) Length = 243 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 44 RLYALRVLKKWGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 102 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 36.7 bits (81), Expect = 0.020 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRL 189 KR+ + ++ + Y TCIRPV YA VF H ++ + L+ Q R R+ Sbjct: 1213 KRANIKVKELLLFYLTCIRPVTEYACPVFHHCLPQYLSNDLERCQKRALRI 1263 >SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) Length = 679 Score = 36.3 bits (80), Expect = 0.027 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 1/95 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 RLY + K+S +S N + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 537 RLYAIRALKKSGLSSNNLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRIV- 595 Query: 196 GAPWFVRNVDLHDDLGLESIGNT*SQRRNDTSIRL 300 N+ H+ L + T QRR I L Sbjct: 596 -----FPNLSYHEALSHAKL-ETLCQRRETACIAL 624 >SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) Length = 479 Score = 36.3 bits (80), Expect = 0.027 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ Y+S FA+ D L+++Q R ++A Sbjct: 364 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYSSAAFANLPNYLSDALENVQRRALKIA 422 >SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) Length = 310 Score = 36.3 bits (80), Expect = 0.027 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 1/95 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 RLY + K+S +S N + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 168 RLYAIRALKKSGLSSNNLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRIV- 226 Query: 196 GAPWFVRNVDLHDDLGLESIGNT*SQRRNDTSIRL 300 N+ H+ L + T QRR I L Sbjct: 227 -----FPNLSYHEALSHAKL-ETLCQRRETACIAL 255 >SB_27289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 35.9 bits (79), Expect = 0.035 Identities = 17/55 (30%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = +1 Query: 19 RLYPMIC-KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSR 177 RLY ++ +R+++ ++ + Y + IRPV+ Y + VF HA +++ D ++ +Q R Sbjct: 469 RLYFIVSLRRARVPTKDIIDFYCSAIRPVLEYCAAVFHHALPSYLSDDIERVQKR 523 >SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 35.5 bits (78), Expect = 0.047 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + KR +S + V +Y + IR V+ YASVVFA+ + ++L+++Q R R+ Sbjct: 690 RLYALRQLKRCGVSPVDIVLVYCSLIRSVIEYASVVFANLPQYLANSLEAIQKRALRI 747 >SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 35.5 bits (78), Expect = 0.047 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 RLY + + K+ + +T+Y++ IR V+ YAS FA+ + L+++Q R ++A Sbjct: 963 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSNALENVQRRALKIA 1021 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 547 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 605 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 606 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 640 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 78 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 136 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 137 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 171 >SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.1 bits (77), Expect = 0.062 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 RLY + KR +S + + +Y++ +R + YASVVFA R D+L +Q R Sbjct: 7 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYPSDSLVRVQKR 60 >SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 78 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRC 136 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 137 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 171 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 298 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 356 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 357 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 391 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 2389 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSEPWTTYARQE-KRLNTFHMRC 2447 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 2448 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 2482 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 78 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRC 136 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 137 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 171 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 130 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 188 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 189 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 223 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 78 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 136 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 137 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 171 >SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 322 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 227 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 285 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 286 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 320 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 113 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSKSWTTYARQE-KRLNTFHMRC 171 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 172 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 206 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 35.1 bits (77), Expect = 0.062 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 130 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 188 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 189 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 223 >SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 764 Score = 34.7 bits (76), Expect = 0.082 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 RLY + KR +S + + +Y++ +R + YASVVFA R D+L +Q R Sbjct: 615 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 668 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 34.7 bits (76), Expect = 0.082 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +1 Query: 19 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 199 APWF--VRNVDLHDDLGLESIGNT*SQRR 279 W V N ++ + GL ++ QRR Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRR 90 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 34.7 bits (76), Expect = 0.082 Identities = 23/95 (24%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ C+ + Y S + AR L + R Sbjct: 469 AVTTMTKLSSRVWENKKLTISTKITVYRACVLSTLLYGSESWTTYARQE-KRLNTFHMRC 527 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 528 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 562 >SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 223 Score = 34.7 bits (76), Expect = 0.082 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +1 Query: 19 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 199 APWF--VRNVDLHDDLGLESIGNT*SQRR 279 W V N ++ + GL ++ QRR Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRR 90 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 34.7 bits (76), Expect = 0.082 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 RLY + KR +S + + +Y++ +R + YASVVFA R D+L +Q R Sbjct: 131 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 184 >SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 403 Score = 34.7 bits (76), Expect = 0.082 Identities = 15/51 (29%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRL 189 KRS ++ V+ ++TC+RP+ YA V+ + +++ ++L+ +Q R R+ Sbjct: 276 KRSGLAKSGLVSFFRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRALRI 326 >SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 173 Score = 34.7 bits (76), Expect = 0.082 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 78 AVTTMTKLSSRVWENKKLTISTKITVYRACILNTLLYGSESWTTYARQE-KRLNTFHMRC 136 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V N ++ + GL ++ QRR Sbjct: 137 LRRILGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 171 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 34.7 bits (76), Expect = 0.082 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +1 Query: 19 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 199 APWF--VRNVDLHDDLGLESIGNT*SQRR 279 W V N ++ + GL ++ QRR Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRR 90 >SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 92 Score = 34.7 bits (76), Expect = 0.082 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +1 Query: 19 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 199 APWF--VRNVDLHDDLGLESIGNT*SQRR 279 W V N ++ + GL ++ QRR Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRR 90 >SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 226 Score = 34.7 bits (76), Expect = 0.082 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +1 Query: 19 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 199 APWF--VRNVDLHDDLGLESIGNT*SQRR 279 W V N ++ + GL ++ QRR Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRR 90 >SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 406 Score = 34.7 bits (76), Expect = 0.082 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +1 Query: 19 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 199 APWF--VRNVDLHDDLGLESIGNT*SQRR 279 W V N ++ + GL ++ QRR Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRR 90 >SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 34.7 bits (76), Expect = 0.082 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +1 Query: 19 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 199 APWF--VRNVDLHDDLGLESIGNT*SQRR 279 W V N ++ + GL ++ QRR Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRR 90 >SB_53921| Best HMM Match : Viral_P18 (HMM E-Value=2.6) Length = 322 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 181 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_52416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 310 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 367 >SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) Length = 798 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 RLY + KR +S + + +Y++ +R + YASVVFA R D+L ++ L++ Sbjct: 731 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLAESRNAPSPLSI 790 Query: 196 GAPWFVRNV 222 A W R + Sbjct: 791 RA-WITRKL 798 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 34.3 bits (75), Expect = 0.11 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 1/95 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 RLY + K+S +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 1019 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRIV- 1077 Query: 196 GAPWFVRNVDLHDDLGLESIGNT*SQRRNDTSIRL 300 N+ H+ L + T QRR I L Sbjct: 1078 -----FPNLSYHEALSHAKL-ETLCQRRETACIAL 1106 >SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) Length = 283 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 181 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) Length = 499 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 401 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 458 >SB_23599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 143 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 200 >SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) Length = 427 Score = 34.3 bits (75), Expect = 0.11 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 1/95 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 RLY + K+S +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 285 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRIV- 343 Query: 196 GAPWFVRNVDLHDDLGLESIGNT*SQRRNDTSIRL 300 N+ H+ L + T QRR I L Sbjct: 344 -----FPNLSYHEALSHAKL-ETLCQRRETACIAL 372 >SB_55213| Best HMM Match : Viral_P18 (HMM E-Value=2.6) Length = 371 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 181 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) Length = 523 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 382 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 439 >SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) Length = 284 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 143 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 200 >SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) Length = 409 Score = 34.3 bits (75), Expect = 0.11 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 1/95 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 RLY + K+S +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 293 RLYAIGALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRIV- 351 Query: 196 GAPWFVRNVDLHDDLGLESIGNT*SQRRNDTSIRL 300 N+ H+ L + T QRR I L Sbjct: 352 -----FPNLSYHEALSHAKL-ETLCQRRETACIAL 380 >SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 559 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + K+S +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 417 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 474 >SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) Length = 595 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +1 Query: 70 VTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 480 ITVYRSLIRSVIEYASAAFANFPNYLSDALENVQRRALKIA 520 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + K+S +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 586 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 643 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 K+ + + + VT+Y + IRP+ YASV+F++ + L+ +Q R Sbjct: 4157 KKCGVPVEDMVTVYCSLIRPITEYASVIFSNIPCYLSEALEKIQRR 4202 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 33.5 bits (73), Expect = 0.19 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 2/82 (2%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWF--V 213 + K+++ K+T+Y+ CI + Y S + AR L + R R +G W V Sbjct: 126 ENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHWSDKV 184 Query: 214 RNVDLHDDLGLESIGNT*SQRR 279 N ++ + GL ++ QRR Sbjct: 185 TNNEVLERSGLPTLFTLLRQRR 206 >SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 541 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/50 (38%), Positives = 31/50 (62%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 KR +S + V +Y + IR V+ YASVVFA+ + + L+++Q R R+ Sbjct: 416 KRCGVSPVDIVLVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 465 >SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 476 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/50 (38%), Positives = 31/50 (62%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 KR +S + V +Y + IR V+ YASVVFA+ + + L+++Q R R+ Sbjct: 351 KRCGVSPVDIVLVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 400 >SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 370 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/72 (23%), Positives = 33/72 (45%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 161 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 219 Query: 181 CRLAVGAPWFVR 216 R +G W ++ Sbjct: 220 LRRILGIHWRIK 231 >SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 379 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 RLY + KR S + + +Y++ +R + YASVVFA D+L+ +Q R Sbjct: 235 RLYAIRQLKRCGASTDDIIVVYRSLVRSTLEYASVVFADLPGYLSDSLERIQKR 288 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 33.1 bits (72), Expect = 0.25 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 3/96 (3%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR- 177 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 301 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 359 Query: 178 FCRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 CR+ +G W V N ++ + GL ++ QRR Sbjct: 360 LCRI-LGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 394 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/69 (24%), Positives = 31/69 (44%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 77 AVTTMSKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 135 Query: 181 CRLAVGAPW 207 R +G W Sbjct: 136 LRRILGIHW 144 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 33.1 bits (72), Expect = 0.25 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 3/96 (3%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR- 177 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 181 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 239 Query: 178 FCRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 CR+ +G W V N ++ + GL ++ QRR Sbjct: 240 LCRI-LGIHWSDKVTNNEVLERSGLPTLFTLLRQRR 274 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 RLY + K+ + +++ VT+Y + IR + YASV+F + + L+ +Q R ++ + Sbjct: 2747 RLYALRTLKKCGVPVKDMVTVYCSLIRSITEYASVIFPNIPCYLSEALEKIQRRALKIII 2806 >SB_4311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.25 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = +1 Query: 79 YKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWFVRNVDLHDDLGLE 249 + I+P+M Y V+ H +T+ LQ R R+ W+ ++ L ++L +E Sbjct: 3 FNALIQPLMDYCITVWGDNLIEHDNTILLLQKRAARIIAYKKWYDHSMALFEELNIE 59 >SB_31881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/50 (24%), Positives = 25/50 (50%) Frame = +1 Query: 97 PVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWFVRNVDLHDDLGL 246 P++ Y ++V+ + HID + Q R R+ + W + L ++L + Sbjct: 1 PILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKWDAPSKPLFEELNI 50 >SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 890 Score = 32.7 bits (71), Expect = 0.33 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 RLY + K+ + + + VT+Y + IR V YASV+F++ + L+ +Q R ++ Sbjct: 773 RLYALRTLKKCGVPVEDMVTVYCSLIRSVTEYASVIFSNIPCYLSEVLEKIQRRALKI 830 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/51 (29%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRL 189 KRS + V+ ++TC+RP+ YA V+ + +++ ++L+ +Q R R+ Sbjct: 670 KRSGLGKSVLVSFFRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRGLRI 720 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 32.7 bits (71), Expect = 0.33 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 2/95 (2%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 187 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 245 Query: 181 CRLAVGAPWF--VRNVDLHDDLGLESIGNT*SQRR 279 R +G W V ++ + GL ++ QRR Sbjct: 246 LRRILGIHWSDKVTKNEVLERSGLPTLFTLIRQRR 280 >SB_1670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.7 bits (71), Expect = 0.33 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSL 168 RLY + + K+ + +T+Y++ IR V+ YAS FA+ + D L+++ Sbjct: 81 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLSNYLSDALENV 131 >SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) Length = 773 Score = 32.7 bits (71), Expect = 0.33 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDT-LQSLQSRFCRL 189 KR+ + + + Y TCIRP YA +F ++ ++ L+S Q R R+ Sbjct: 676 KRAHVKPKELILFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRVLRI 726 >SB_49069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.43 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +1 Query: 97 PVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWFVRNVDLHDDLGL 246 P++ Y +V+ + HID + Q R R+ + W + L ++L + Sbjct: 1 PILDYGDIVWGSTKKQHIDDMVKFQKRCARVILDKKWDAPSKPLFEELNI 50 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/69 (24%), Positives = 31/69 (44%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 509 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRC 567 Query: 181 CRLAVGAPW 207 R +G W Sbjct: 568 LRRILGIHW 576 >SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) Length = 1130 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/60 (26%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = +1 Query: 19 RLYPMIC-KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRLA 192 RLY ++ KR+ + + + + Y TC+RP++ Y + + HA ++ + L+ +Q +A Sbjct: 271 RLYFLVLLKRTIVPVSDIIGFYDTCVRPILEYCAPLSYHAIPAYLKEDLEHIQKSALSIA 330 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDT-LQSLQSRFCRL 189 KR+ + + + Y TCIRP YA +F ++ ++ L+S Q R R+ Sbjct: 669 KRAHVKPKELILFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRALRI 719 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +1 Query: 79 YKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFCR 186 YKT +RP + YAS V++ ID ++++Q +RFC+ Sbjct: 516 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 554 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +1 Query: 79 YKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFCR 186 YKT +RP + YAS V++ ID ++++Q +RFC+ Sbjct: 98 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 136 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +1 Query: 79 YKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFCR 186 YKT +RP + YAS V++ ID ++++Q +RFC+ Sbjct: 584 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 622 >SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 407 Score = 32.3 bits (70), Expect = 0.43 Identities = 11/51 (21%), Positives = 26/51 (50%) Frame = +1 Query: 94 RPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWFVRNVDLHDDLGL 246 +P++ Y ++V+ + HID + Q R R+ + W + + ++L + Sbjct: 291 KPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKWDAPSKPVFEELNI 341 >SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) Length = 132 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 70 VTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 + +Y++ +R + YASVVFA R D+L+ +Q R Sbjct: 6 LVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 41 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = +1 Query: 19 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 464 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 522 Query: 199 APW 207 W Sbjct: 523 IHW 525 >SB_6318| Best HMM Match : RVT_1 (HMM E-Value=0.72) Length = 485 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSL 168 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++ Sbjct: 435 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENV 485 >SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) Length = 692 Score = 31.5 bits (68), Expect = 0.76 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 1/95 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 195 RLY + K+ +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 550 RLYAIRALKKCGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQIKVLRIV- 608 Query: 196 GAPWFVRNVDLHDDLGLESIGNT*SQRRNDTSIRL 300 N+ H+ L + T QRR I L Sbjct: 609 -----FPNLSYHEALSHAKL-ETLCQRRETACIAL 637 >SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 31.5 bits (68), Expect = 0.76 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 64 NKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 +++T Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 118 HRITDYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 162 >SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 31.5 bits (68), Expect = 0.76 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRL 189 KR+ + Y TCIRP+M YA VF ++ ++ L+ ++ R R+ Sbjct: 331 KRASLGSEELHQFYLTCIRPIMEYACPVFHNSLPDYLSQDLEIIRRRALRI 381 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 31.1 bits (67), Expect = 1.0 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 118 RVKVTAYTAIVRPMLEYASAAWDPHLKKDIASLEKVQRKAARFC 161 >SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 898 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 RLY + KRS ++ + +Y IRP+M YA VFA + L+ +Q R Sbjct: 687 RLYALRKLKRSGVADSEIIQVYCCLIRPIMEYACAVFADLPQYLSHALERVQKR 740 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 909 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 952 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 14 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 57 >SB_35414| Best HMM Match : NinE (HMM E-Value=8.4) Length = 172 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/66 (24%), Positives = 32/66 (48%) Frame = +1 Query: 43 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWFVRNV 222 RS + L ++ + I+PVM YA+V+++ + + Q R R + A ++ Sbjct: 35 RSYLPLNQRINHFNAIIKPVMNYANVIWSTCDKESQYRILKFQKRAARTILYAGRLTPSI 94 Query: 223 DLHDDL 240 +L + L Sbjct: 95 ELFNRL 100 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 215 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 258 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +1 Query: 22 LYPMICKRSKMSLRNKVTLYKTCIRPVMTYAS 117 L P++C +S +SL + +Y +C+R + YAS Sbjct: 474 LLPILCSKS-LSLHTRGRIYSSCVRGALLYAS 504 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 201 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 244 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 447 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 490 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 631 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 674 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 733 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 776 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 421 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 464 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 664 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 707 >SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/59 (32%), Positives = 27/59 (45%) Frame = +1 Query: 22 LYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 L + K+ +S K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 158 LNEQLTKQIVLSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 216 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 623 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 666 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 506 RVKVTAYTAIVRPMLEYASAAWDPYLQKDIASLEKVQRKAARFC 549 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 61 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 183 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 439 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 482 >SB_15503| Best HMM Match : DUF217 (HMM E-Value=5.3) Length = 196 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/51 (23%), Positives = 24/51 (47%) Frame = +1 Query: 94 RPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWFVRNVDLHDDLGL 246 +P++ Y V+ + HID + Q R R+ + W + L ++L + Sbjct: 97 KPILDYGVFVWGSTKKQHIDDMVKFQKRCARVILDKKWDAPSKPLFEELNI 147 >SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) Length = 844 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/74 (22%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Frame = +1 Query: 34 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPW 207 + +R+K +S+ + + I+P+M Y V+ +T+ LQ R R+ W Sbjct: 670 LLRRTKHFLSMTARKMFFNVLIQPLMDYCITVWGDNLIELDNTMLLLQKRAARIIPDKKW 729 Query: 208 FVRNVDLHDDLGLE 249 + ++ L ++L +E Sbjct: 730 YDHSMALFEELNIE 743 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +1 Query: 73 TLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 +LY + +RP + YAS V+A A T + ++++LQ R Sbjct: 858 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRR 892 >SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +1 Query: 70 VTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 189 V +Y + IR ++ YA+VVF++ + + L+ +Q R R+ Sbjct: 132 VAVYCSLIRSILEYATVVFSNLPKYLSEALEKVQKRSLRI 171 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +1 Query: 73 TLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 +LY + +RP + YAS V+A A T + ++++LQ R Sbjct: 449 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRR 483 >SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) Length = 488 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +1 Query: 73 TLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 +LY + +RP + YAS V+A A T + ++++LQ R Sbjct: 392 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRR 426 >SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08) Length = 652 Score = 30.3 bits (65), Expect = 1.8 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 2/80 (2%) Frame = +1 Query: 22 LYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR-LAVG 198 L P++ +S +SLR + +Y +C+R M YA +A + + + LQ + R + V Sbjct: 549 LLPVLSSKS-LSLRTRGKVYSSCVRSAMLYAGECWAPKS-SDLARLQRSEHAMLRWICVL 606 Query: 199 APWFVRNVD-LHDDLGLESI 255 P ++ + D LG+ES+ Sbjct: 607 KPEDDTSLSTIRDRLGIESL 626 >SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) Length = 449 Score = 29.9 bits (64), Expect = 2.3 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 2/82 (2%) Frame = +1 Query: 40 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWF--V 213 +R K L ++T+Y+ CI + Y S + AR L + R R +G W V Sbjct: 42 ERVKGYLNVQITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHWSDKV 100 Query: 214 RNVDLHDDLGLESIGNT*SQRR 279 N ++ + GL ++ QRR Sbjct: 101 TNNEVLERSGLPTLFTLLRQRR 122 >SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 77 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 136 Query: 187 LAVGAPWFVRNVDLHDDL 240 L + A +V L + L Sbjct: 137 LILNAEPRAPSVPLFNKL 154 >SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) Length = 952 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 19 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 RLY + KRS ++ + +Y IRP+M YA VFA + L+ +Q R Sbjct: 808 RLYALRKLKRSGVADSEIMQVYCRLIRPIMEYACTVFADLPQYLSHALERVQKR 861 >SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) Length = 707 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +1 Query: 70 VTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 177 V +Y + IR ++ YASVVF++ + + L+ +Q R Sbjct: 639 VAVYCSLIRSILEYASVVFSNLPKYLSEALEKVQKR 674 >SB_34939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 186 RLY + + K+S ++ + VT+Y + IR + YAS +A + L+S+Q + R Sbjct: 164 RLYGLRVLKKSGLASEDLVTVYCSIIRSTLEYASPAWAALPGYLSELLESVQRKALR 220 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 404 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 463 Query: 187 LAVGA 201 L + A Sbjct: 464 LILNA 468 >SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 79 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 138 Query: 187 LAVGA 201 L + A Sbjct: 139 LILNA 143 >SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 29.5 bits (63), Expect = 3.1 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + ++ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 198 IAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 257 Query: 187 LAVGAPWFVRNVDLHDDL 240 L + A +V L + L Sbjct: 258 LILNAEHRAPSVPLFNRL 275 >SB_7040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + ++ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 139 IAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDSLSKFLTLQKRAAR 198 Query: 187 LAVGA 201 L + A Sbjct: 199 LILNA 203 >SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 187 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 246 Query: 187 LAVGA 201 L + A Sbjct: 247 LILNA 251 >SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) Length = 238 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 139 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 198 Query: 187 LAVGA 201 L + A Sbjct: 199 LILNA 203 >SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1415 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 198 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 257 Query: 187 LAVGA 201 L + A Sbjct: 258 LILNA 262 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 29.5 bits (63), Expect = 3.1 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGA-PWFVRNVDLHDDLG 243 K Y + IRPVM YAS V+ I+ L+ +Q R G + DL L Sbjct: 436 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 495 Query: 244 LESI 255 L+S+ Sbjct: 496 LDSL 499 >SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 114 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 173 Query: 187 LAVGA 201 L + A Sbjct: 174 LILNA 178 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 701 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 760 Query: 187 LAVGA 201 L + A Sbjct: 761 LILNA 765 >SB_51188| Best HMM Match : RVT_1 (HMM E-Value=4.5e-24) Length = 505 Score = 29.1 bits (62), Expect = 4.1 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = +1 Query: 43 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDT---LQSLQSRFCRLAVGAPWFV 213 RS ++L K L+ I+P++ Y S V+ ++ +D L+S+ +FC++ +G Sbjct: 262 RSDINLTLK--LFDALIKPILLYGSEVWGADNKSCVDDRDPLESVHLKFCKMLLGTGKTA 319 Query: 214 RNVDLHDDLG 243 N +LG Sbjct: 320 VNNACRGELG 329 >SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) Length = 434 Score = 29.1 bits (62), Expect = 4.1 Identities = 22/84 (26%), Positives = 37/84 (44%) Frame = +1 Query: 43 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWFVRNV 222 R+ + K+ LYK+ + P +TY + + + L+ LQ R R AV W N Sbjct: 341 RNLIPTNAKLVLYKSAVLPYLTYCHLTWHFCKASDSRKLERLQERALR-AVFKDW---NC 396 Query: 223 DLHDDLGLESIGNT*SQRRNDTSI 294 H+ L ++ ++R D I Sbjct: 397 TYHELLIKANLSTLRNRRLQDICI 420 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 755 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 798 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 259 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) Length = 449 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 159 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 202 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 29.1 bits (62), Expect = 4.1 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = +1 Query: 43 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDT---LQSLQSRFCRLAVGAPWFV 213 RS ++L K L+ I+P++ Y S V+ ++ +D L+S+ +FC++ +G Sbjct: 1628 RSDINLTLK--LFDALIKPILLYGSEVWGADNKSCVDDRDPLESVHLKFCKMLLGTGKTA 1685 Query: 214 RNVDLHDDLG 243 N +LG Sbjct: 1686 VNNACRGELG 1695 >SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 989 Score = 29.1 bits (62), Expect = 4.1 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 7/80 (8%) Frame = +1 Query: 46 SKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI--DTLQSLQSRFCRLAVGAPWFVRN 219 S MSL + L+ + ++P + Y S ++A + + D ++ +Q +FC++ +G N Sbjct: 509 SDMSLT--IRLFDSFVKPALLYGSELWALEGKYNEMRDPIEQVQIKFCKMLLGVGKRAAN 566 Query: 220 VDLHDDLG-----LESIGNT 264 +LG +E+I NT Sbjct: 567 SACRAELGRFPLRIETIKNT 586 >SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) Length = 858 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 76 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 204 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 728 LYCTLVRPHLEYASCIWSPSTGKHKALIENIQCRASKFILNYP 770 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 35 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 78 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 121 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 164 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 80 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 123 >SB_1766| Best HMM Match : Nodulin_late (HMM E-Value=7.2) Length = 265 Score = 29.1 bits (62), Expect = 4.1 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = +1 Query: 43 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDT---LQSLQSRFCRLAVGAPWFV 213 RS ++L K L+ I+P++ Y S V+ ++ +D L+S+ +FC++ +G Sbjct: 59 RSDINLTLK--LFDALIKPILLYGSEVWGADNKSCVDDRDPLESVHLKFCKMLLGTGKTA 116 Query: 214 RNVDLHDDLG 243 N +LG Sbjct: 117 VNNACRGELG 126 >SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 78 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRC 136 Query: 181 CRLAVG 198 R +G Sbjct: 137 LRRILG 142 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 76 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 204 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 631 LYCTLVRPSLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 673 >SB_52705| Best HMM Match : RnaseA (HMM E-Value=1.4) Length = 346 Score = 29.1 bits (62), Expect = 4.1 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = +1 Query: 43 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDT---LQSLQSRFCRLAVGAPWFV 213 RS ++L K L+ I+P++ Y S V+ ++ +D L+S+ +FC++ +G Sbjct: 59 RSDINLTLK--LFDALIKPILLYGSEVWGADNKSCVDDRDPLESVHLKFCKMLLGTGKTA 116 Query: 214 RNVDLHDDLG 243 N +LG Sbjct: 117 VNNACRGELG 126 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 1462 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 1505 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 80 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 123 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 446 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 489 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 259 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 29.1 bits (62), Expect = 4.1 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = +1 Query: 43 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDT---LQSLQSRFCRLAVGAPWFV 213 RS ++L K L+ I+P++ Y S V+ ++ +D L+S+ +FC++ +G Sbjct: 611 RSDINLTLK--LFDALIKPILLYGSEVWGADNKSCVDDRDPLESVHLKFCKMLLGTGKTA 668 Query: 214 RNVDLHDDLG 243 N +LG Sbjct: 669 VNNACRGELG 678 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 76 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 204 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 134 LYCTLVRPSLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 176 >SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 74 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLTRFLTLQKRAAR 133 Query: 187 LAVGA 201 L + A Sbjct: 134 LILNA 138 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 674 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 717 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 76 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 204 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 134 LYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFVLNYP 176 >SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRF 180 A + +L + + K+++ K+T+Y+ CI + Y S + AR L + R Sbjct: 78 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRC 136 Query: 181 CRLAVG 198 R +G Sbjct: 137 LRRILG 142 >SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) Length = 244 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 67 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 198 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 141 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 184 >SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 76 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 204 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 86 LYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 128 >SB_29894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 28.7 bits (61), Expect = 5.4 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = +1 Query: 43 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDT---LQSLQSRFCRLAVGAPWFV 213 RS ++L K L+ I+P++ Y S V+ ++ +D L+S+ +FC++ +G Sbjct: 565 RSDINLTLK--LFDALIKPIILYGSEVWGADNKSCVDDRDPLESVHLKFCKMLLGTGKTA 622 Query: 214 RNVDLHDDLG 243 N +LG Sbjct: 623 VNNACRGELG 632 >SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) Length = 319 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + ++ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 180 IAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 239 Query: 187 LAVGA 201 L + A Sbjct: 240 LILNA 244 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAAR 141 A + +L + + K+++ K+T+Y+ CI + Y S + AR Sbjct: 591 AVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYAR 637 >SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) Length = 1354 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 76 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 204 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 879 LYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 921 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 76 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 204 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 1772 LYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 1814 >SB_17216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 10 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 186 I GR+ + + + ++ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 79 IAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 138 Query: 187 LAVGA 201 L + A Sbjct: 139 LILNA 143 >SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 76 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 204 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 555 LYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 597 >SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 76 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 204 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 139 LYCTFVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 181 >SB_47925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 28.3 bits (60), Expect = 7.1 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 7/63 (11%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYA----SVVFAHAA---RTHIDTL 159 A+ GRL + R +S++ K+ +YK + P++ Y+ +V +HA R H++ L Sbjct: 74 ASTAFGRLRKKVWGRRGLSMKTKLKVYKAIVLPLLLYSCETWTVYSSHAKKLDRFHMNCL 133 Query: 160 QSL 168 + + Sbjct: 134 RKI 136 >SB_42199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.3 bits (60), Expect = 7.1 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 7/63 (11%) Frame = +1 Query: 1 AAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYA----SVVFAHAA---RTHIDTL 159 A+ GRL + R +S++ K+ +YK + P++ Y+ +V +HA R H++ L Sbjct: 74 ASTAFGRLRKKVWGRRGLSMKTKLKVYKAIVLPLLLYSCETWTVYSSHAKKLDRFHMNCL 133 Query: 160 QSL 168 + + Sbjct: 134 RKI 136 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 186 RLY + + K+S ++ + T+Y + +R + YAS +A + L+S+Q + R Sbjct: 4375 RLYGLRVLKKSGLTSEDLATVYCSIVRSTLEYASPAWAALPGYLSELLESVQRKAMR 4431 >SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) Length = 272 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 19 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFA 129 RLY + K+S +S + + +Y + +RPV+ YAS V++ Sbjct: 229 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWS 266 >SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1603 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 25 YPMICKRSKMSLRNKVTLYKTCIRPVMTYASVV 123 + + K + S R +VTL+ +RPV+ +A +V Sbjct: 579 FAQLLKARRQSHRERVTLHSLMLRPVIRFAQLV 611 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,969,441 Number of Sequences: 59808 Number of extensions: 422474 Number of successful extensions: 1395 Number of sequences better than 10.0: 195 Number of HSP's better than 10.0 without gapping: 1307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1394 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -