BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31030 (752 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 30 0.088 Z49813-1|CAA89967.1| 247|Anopheles gambiae serine proteinase pr... 24 4.4 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 29.9 bits (64), Expect = 0.088 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 43 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 192 R + LRN LY +RP++ YAS+++ ++S+Q F R+A Sbjct: 812 RDQSFLRN---LYYALVRPLLEYASIIWNPPTIDGCSRIESIQRLFTRVA 858 >Z49813-1|CAA89967.1| 247|Anopheles gambiae serine proteinase protein. Length = 247 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 181 CRLAVGAPWFVRNVDLHDDLGLESIG 258 C+ G P VRN D H+ +G+ S G Sbjct: 188 CQGDSGGPLLVRNGDKHEIVGIVSWG 213 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,953 Number of Sequences: 2352 Number of extensions: 13767 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -