BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31023 (812 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 26 1.2 AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like p... 26 1.2 AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like p... 26 1.2 AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like p... 26 1.2 AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like pepti... 26 1.6 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 25 2.8 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 2.8 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 25 2.8 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 25 2.8 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 25 2.8 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 24 4.8 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 24 4.8 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 24 4.8 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 24 4.8 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 24 6.4 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 26.2 bits (55), Expect = 1.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 155 EGEEKKDDKAIEPPMDPNV 211 E EE DD+ +E P++PNV Sbjct: 162 EDEEYDDDQYLEEPIEPNV 180 >AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 26.2 bits (55), Expect = 1.2 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +2 Query: 56 GTYEPNDDECLN---PWRDDTEE 115 GTY+ DDE LN P DD EE Sbjct: 143 GTYQATDDEGLNTDSPLEDDAEE 165 >AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 26.2 bits (55), Expect = 1.2 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +2 Query: 56 GTYEPNDDECLN---PWRDDTEE 115 GTY+ DDE LN P DD EE Sbjct: 143 GTYQATDDEGLNTDSPLEDDAEE 165 >AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 26.2 bits (55), Expect = 1.2 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +2 Query: 56 GTYEPNDDECLN---PWRDDTEE 115 GTY+ DDE LN P DD EE Sbjct: 143 GTYQATDDEGLNTDSPLEDDAEE 165 >AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like peptide 2 precursor protein. Length = 134 Score = 25.8 bits (54), Expect = 1.6 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 765 PGVPSPGVEPARHETRRASRMYDDLKVRSQQRLYIRGDC 649 PG P PG R R + +YD+ +S + +R C Sbjct: 95 PGFPYPGAGVHRRSRRSSGGIYDECCKKSCSYVELRAYC 133 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 25.0 bits (52), Expect = 2.8 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -2 Query: 223 WDTLYIGIHWRLDSLVILLFLTLSDGSILYRP 128 WDT Y + W D++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 25.0 bits (52), Expect = 2.8 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +1 Query: 316 KVQMHEDPISFTLEFYFAPNEYFTNTVLTKEY 411 ++Q H DP+ + F P YFT + Y Sbjct: 21 RIQGHSDPLGHSTPGSFDPQGYFTPPIANVGY 52 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.0 bits (52), Expect = 2.8 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -2 Query: 223 WDTLYIGIHWRLDSLVILLFLTLSDGSILYRP 128 WDT Y + W D++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.0 bits (52), Expect = 2.8 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -2 Query: 223 WDTLYIGIHWRLDSLVILLFLTLSDGSILYRP 128 WDT Y + W D++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.0 bits (52), Expect = 2.8 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -2 Query: 223 WDTLYIGIHWRLDSLVILLFLTLSDGSILYRP 128 WDT Y + W D++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 32 FTFSFYTPALDYYLNHPIRKYIILKDLPD 60 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 32 FTFSFYTPALDYYLNHPIRKYIILKDLPD 60 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 346 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 432 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.8 bits (49), Expect = 6.4 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 178 QGYRASNGSQCKGYPRLLVQHIQECLMLSEMMQEH 282 QG+RA GS PRL H+ + L + + H Sbjct: 829 QGFRALQGSTGAVGPRLFTIHLTADVPLQNLPKAH 863 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 763,179 Number of Sequences: 2352 Number of extensions: 14370 Number of successful extensions: 89 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86071221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -