BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31021 (724 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021567-3|CAA16509.2| 650|Caenorhabditis elegans Hypothetical ... 29 2.5 AF040649-4|ABS19468.1| 152|Caenorhabditis elegans Hypothetical ... 28 7.8 >AL021567-3|CAA16509.2| 650|Caenorhabditis elegans Hypothetical protein F21A10.4 protein. Length = 650 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -1 Query: 550 KKSFWLMKLGLIIPNKSLKIIKMRLLTRIVVKHVFIYNISLMK 422 +KS + L++P +SL I M L +VVKH + I + K Sbjct: 221 QKSTANTSISLVVPPESLISISMSLWNVLVVKHEIVLEIKMQK 263 >AF040649-4|ABS19468.1| 152|Caenorhabditis elegans Hypothetical protein F33H12.7 protein. Length = 152 Score = 27.9 bits (59), Expect = 7.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 562 IDGLKKSFWLMKLGLIIPNKSLK 494 +D + WL +LG +IPN+S+K Sbjct: 74 VDAVIDQVWLEELGKLIPNRSIK 96 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,382,512 Number of Sequences: 27780 Number of extensions: 358708 Number of successful extensions: 868 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -