BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31020 (545 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 25 1.6 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 5.0 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 23 8.7 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -2 Query: 355 YLASCVLNV*HFIYELKPCYRPF-SW 281 Y +SC +NV +F Y+ + C F SW Sbjct: 150 YKSSCEMNVEYFPYDEQTCLMKFGSW 175 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = -2 Query: 355 YLASCVLNV*HFIYELKPCYRPFSWKNY*FN*VVEKHQS 239 + +SC ++V +F ++ + C+ F Y N + KH++ Sbjct: 156 FKSSCEIDVRYFPFDQQTCFMKFGSWTYDGNQIDLKHKN 194 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 545 DFAIFISNGECENLG 501 DF IF+ GE NLG Sbjct: 416 DFDIFLLGGELSNLG 430 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 530,785 Number of Sequences: 2352 Number of extensions: 10230 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -