BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31019 (878 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 27 0.30 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.8 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 26.6 bits (56), Expect = 0.30 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 123 ISRTNSADDNKIATAESCCFVDSVADL-ENTIQIVTKIRPIS 1 I +N D +K+ +S C +DS D E T VT +R IS Sbjct: 265 IGGSNGLDTSKVHIIDSICGIDSKPDYRELTEYSVTSVRLIS 306 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 407 VLNFMEDASNSPVNMTM 357 + N +EDASN PV+ T+ Sbjct: 432 IANELEDASNIPVHATL 448 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,466 Number of Sequences: 438 Number of extensions: 5522 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28523595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -