BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31016 (850 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosacc... 27 4.4 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 26 7.8 >SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 26.6 bits (56), Expect = 4.4 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +2 Query: 509 GDRSRCSLRCTCGCLQDHQSCSIFCVILLPLPQPMGGSYGGLYAAPAVSN 658 G S + +C HQ +I LLPL +GG+ G A+P SN Sbjct: 477 GSFSVVGSQVSCQASVPHQDLAI-ASSLLPLYTNIGGAIGAAIASPIFSN 525 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 25.8 bits (54), Expect = 7.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 596 PLPQPMGGSYGGLYAAPAVSN 658 P P P+ + GG + +PAVSN Sbjct: 949 PPPPPLVSAAGGKFVSPAVSN 969 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,910,892 Number of Sequences: 5004 Number of extensions: 51551 Number of successful extensions: 130 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -