BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31012 (828 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1450.15 |||pig-F |Schizosaccharomyces pombe|chr 3|||Manual 28 1.9 SPBC1683.03c |||membrane transporter|Schizosaccharomyces pombe|c... 27 4.3 SPAC57A7.10c |sec21||coatomer gamma subunit Sec21 |Schizosacchar... 26 5.7 SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces... 26 5.7 SPBC119.06 |sco1||copper chaperone Sco1|Schizosaccharomyces pomb... 25 9.9 >SPCC1450.15 |||pig-F |Schizosaccharomyces pombe|chr 3|||Manual Length = 503 Score = 27.9 bits (59), Expect = 1.9 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 76 LFVLSLFYTKA*VFYLSIEALRSLPGQLVRN 168 +F L L +T+ +FYLS+ L P +++RN Sbjct: 321 IFTLLLTFTQLTIFYLSLNCLIENPYRMLRN 351 >SPBC1683.03c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 519 Score = 26.6 bits (56), Expect = 4.3 Identities = 15/47 (31%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +2 Query: 575 WLTASYSSVNGTILL-----GKYLXXXXXXXXXXXWRCEWHTLTGFS 700 W ASYS GT +L G W C W ++GFS Sbjct: 86 WFPASYSLTVGTFILIAGRLGDIYGHKKMFVLGYIWFCIWSLISGFS 132 >SPAC57A7.10c |sec21||coatomer gamma subunit Sec21 |Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 26.2 bits (55), Expect = 5.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 794 YGKFTIRVLTPLWEGSPKYQNVLWSTRYMYHR 699 Y K +R+L+ L E PK RY+Y+R Sbjct: 468 YPKIAVRILSILGEEGPKASEPTRFIRYIYNR 499 >SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1639 Score = 26.2 bits (55), Expect = 5.7 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -1 Query: 666 HFLTTRQWRTLLRYFPNKIVPLTDE*DAVSHFSTTFVDL 550 H + +++ + RYF + VPL D +V HF T D+ Sbjct: 791 HEIRLQRFDNVYRYFICRAVPLRDCTGSVLHFFGTMTDV 829 >SPBC119.06 |sco1||copper chaperone Sco1|Schizosaccharomyces pombe|chr 2|||Manual Length = 263 Score = 25.4 bits (53), Expect = 9.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 712 YLVDHKTFWYFGDP 753 YLVDH F+Y DP Sbjct: 218 YLVDHSVFFYLMDP 231 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,660,329 Number of Sequences: 5004 Number of extensions: 80784 Number of successful extensions: 157 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 406444570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -