BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31011 (843 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45000.1 68415.m05603 expressed protein contains Pfam profile... 33 0.31 At1g21380.1 68414.m02675 VHS domain-containing protein / GAT dom... 32 0.41 At4g23840.1 68417.m03428 leucine-rich repeat family protein 31 0.72 At4g00820.1 68417.m00113 calmodulin-binding protein-related cont... 30 1.7 At2g06845.1 68415.m00766 expressed protein 30 1.7 At5g53030.2 68418.m06586 expressed protein 30 2.2 At5g53030.1 68418.m06587 expressed protein 30 2.2 At5g03740.1 68418.m00335 zinc finger (C2H2 type) family protein ... 30 2.2 At5g44100.1 68418.m05396 casein kinase, putative similar to dual... 29 2.9 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 29 5.1 At1g11540.1 68414.m01325 expressed protein contains Pfam profil... 29 5.1 At3g12340.2 68416.m01539 immunophilin, putative / FKBP-type pept... 28 6.8 At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type pept... 28 6.8 At5g36150.1 68418.m04356 pentacyclic triterpene synthase, putati... 28 8.9 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 28 8.9 >At2g45000.1 68415.m05603 expressed protein contains Pfam profile: PF05064 Nsp1-like C-terminal region Length = 739 Score = 32.7 bits (71), Expect = 0.31 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 5/80 (6%) Frame = +2 Query: 518 NPLK-GFRQFQQPAPAGFKLNRNTNG----SSSRAFQFQVSSTSPNYQTAASVTKQTPKF 682 +PL F Q P+ GF + + S++ +F F SST P++ +S + TP F Sbjct: 33 SPLSFSFNQSSNPSSTGFGFGSSVSSTPASSTTPSFGFGASST-PSFGFGSSASSSTPSF 91 Query: 683 NFPTRGHFQPPNFNSPKFNY 742 F + P + +P F + Sbjct: 92 GFGSSASVTPAS-TTPSFGF 110 >At1g21380.1 68414.m02675 VHS domain-containing protein / GAT domain-containing protein weak similarity to Hrs [Rattus norvegicus] GI:8547026; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 506 Score = 32.3 bits (70), Expect = 0.41 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +3 Query: 141 QGQGSNVPATTPVPI-LKQINRQNDDGSYSYGYEAADGSSRLKRSTLMGMSRGN 299 + +G++VPAT P PI L IN +DD + + R KR + G +GN Sbjct: 266 KAKGNSVPATAPTPIPLVSINHDDDDDESDDDF--LQLAHRSKRESARGTGQGN 317 >At4g23840.1 68417.m03428 leucine-rich repeat family protein Length = 597 Score = 31.5 bits (68), Expect = 0.72 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 353 CWLRTRSPFVSRSRRYTHISPRHPH 279 CWL T+ +RY HI RH H Sbjct: 490 CWLLTKDDIAGLCKRYPHIKVRHEH 514 >At4g00820.1 68417.m00113 calmodulin-binding protein-related contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 534 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 572 LNRNTNGSSSRAFQFQVSSTSPNYQTAASVTKQTPKF 682 L R +N S S+AF QV T +Y T ++ PK+ Sbjct: 261 LRRESNNSISQAFSHQVRRTRGSYSTGDEYEEERPKW 297 >At2g06845.1 68415.m00766 expressed protein Length = 315 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 205 CLLICFNIGTGVVAGTFDPWPCISSHAEQNTRVFKT 98 C L C TG+ +G PW C S +N +VF T Sbjct: 126 CKLACLP-PTGIASGPLAPWICWSLWKSRNQKVFST 160 >At5g53030.2 68418.m06586 expressed protein Length = 224 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 469 GPEDLRRPEIQWQKSAKPAQRLQTVPATSPSR 564 GP DLRR + +SA ++L+ VPA +P + Sbjct: 103 GPYDLRRRSLSLPRSAAVIRKLRGVPAPAPEK 134 >At5g53030.1 68418.m06587 expressed protein Length = 245 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 469 GPEDLRRPEIQWQKSAKPAQRLQTVPATSPSR 564 GP DLRR + +SA ++L+ VPA +P + Sbjct: 103 GPYDLRRRSLSLPRSAAVIRKLRGVPAPAPEK 134 >At5g03740.1 68418.m00335 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 287 Score = 29.9 bits (64), Expect = 2.2 Identities = 22/80 (27%), Positives = 33/80 (41%) Frame = +2 Query: 257 KIETKYPNGDVAGKYGYIDESGKQREISYGASSARGFEPQGAGIMVPPPTLHDPSSNALT 436 ++ + PN DV K D G + + S S + + + + D SS Sbjct: 117 QVNFQLPNEDVKAKQDD-DADGSEEDSSDDDDSENSGDEEEEKVTAESDSEEDDSS---- 171 Query: 437 DGQEDDGQYREDPKIYEDPK 496 D +EDD E PK E+PK Sbjct: 172 DDEEDDSSEEETPKKPEEPK 191 >At5g44100.1 68418.m05396 casein kinase, putative similar to dual specificity kinase 1 gi|1216484|gb|AAB47968 Length = 476 Score = 29.5 bits (63), Expect = 2.9 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 4/73 (5%) Frame = +3 Query: 162 PATTPVPILKQINRQNDDGSYS---YG-YEAADGSSRLKRSTLMGMSRGNMGISTRAGNK 329 P TT P + +R +DDG +S +G E A+ SSR + S+ + + AG Sbjct: 351 PTTTSSPRDRSRSRNSDDGPFSKQTHGDSERANSSSRYRASSSRKAVAASSSRPSSAGGP 410 Query: 330 GRSRTEPAALEDS 368 SRT + S Sbjct: 411 SESRTSSRLVSSS 423 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 28.7 bits (61), Expect = 5.1 Identities = 26/87 (29%), Positives = 34/87 (39%), Gaps = 3/87 (3%) Frame = +2 Query: 266 TKYPNGDVAGKYGYIDESGKQREISYGASSARGF---EPQGAGIMVPPPTLHDPSSNALT 436 T+ P+G YGY SG + YG +A G P G G ++P S Sbjct: 331 TQSPSGYSNQGYGYGGYSGS--DSGYGNQAAYGVVGGRPSGGGS-------NNPGSGGYM 381 Query: 437 DGQEDDGQYREDPKIYEDPKYNGRRAR 517 G DG +R DP YN + R Sbjct: 382 GGGYGDGSWRSDPSQGYGGGYNDGQGR 408 >At1g11540.1 68414.m01325 expressed protein contains Pfam profile: PF01925 domain of unknown function DUF81 Length = 367 Score = 28.7 bits (61), Expect = 5.1 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = -3 Query: 619 LELKSSGTAAVGIAVKFEAGWGWLLELSEAFERVSRSSAIVFRVFVDLRVLAVL 458 L ++ +GTAA+ V F A L+ + + + R+S IVF V + + + VL Sbjct: 289 LGMEHAGTAAIFALVCFVASLVGLMVVKKVIAKYGRASIIVFAVGIVMALSTVL 342 >At3g12340.2 68416.m01539 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative contains Pfam profile: PF00254, FKBP-type peptidyl-prolyl cis-trans isomerases Length = 186 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +2 Query: 305 YIDESGKQREISYGASSARGFEPQGAGIMVPPPTLHDPSSNAL 433 Y +GK+ E+ + G +G GI +PP +L + S L Sbjct: 71 YRSGTGKKAEVRKSKKGSSGSPSKGTGIYLPPVSLKEAVSGGL 113 >At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative contains Pfam profile: PF00254, FKBP-type peptidyl-prolyl cis-trans isomerases Length = 694 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +2 Query: 305 YIDESGKQREISYGASSARGFEPQGAGIMVPPPTLHDPSSNAL 433 Y +GK+ E+ + G +G GI +PP +L + S L Sbjct: 71 YRSGTGKKAEVRKSKKGSSGSPSKGTGIYLPPVSLKEAVSGGL 113 >At5g36150.1 68418.m04356 pentacyclic triterpene synthase, putative similar to pentacyclic triterpene synthase [gi:6650208] [PMID:11247608]; oxidosqualene cyclase; also highly similar to beta-amyrin synthase, lupeol synthase, cycloartenol synthase Length = 729 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -1 Query: 402 GGGTMIPAPWGSNPLALLAPYEISLCFPLSSIYPYFPATSPL 277 GG T P +G L++L YE S C P+ + +FP+ P+ Sbjct: 212 GGATYTPL-FGKAWLSVLGVYEWSGCKPIPPEFWFFPSYFPI 252 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 683 NFPTRGHFQPPNFNSPKFNYKVRRLFLAG-KNQFFFNSGDL*KVSLQRPN 829 N P GH QPP +P + + +AG +N F SG + + + PN Sbjct: 297 NMPFYGHSQPPPGFNPMYGAMMGNPMVAGLQNYRMFGSGMMNQGPMMPPN 346 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,311,428 Number of Sequences: 28952 Number of extensions: 438789 Number of successful extensions: 1426 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1426 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1950880000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -