BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31009 (842 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 25 1.2 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 23 3.5 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 24.6 bits (51), Expect = 1.2 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +3 Query: 453 CSRTSPRTS*AKTSSYPCWAPPQKHYKIIFIKGPNSSHSYCPHNS 587 CS+TS S +T S C P H K+ I S+ NS Sbjct: 365 CSQTSVHYSNGQTHSQLCPTPRSTHLKVSGINRVGSTRRPSRRNS 409 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.0 bits (47), Expect = 3.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 393 SSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKA 277 ++ +S A AAAA +T +S R ++ GN A A Sbjct: 125 TAASSAALAAAAAVDAATAGDKSCRYTASLAGNVAPASA 163 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,738 Number of Sequences: 438 Number of extensions: 4084 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -