BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31007 (477 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8KD82 Cluster: Putative uncharacterized protein; n=1; ... 33 4.3 UniRef50_UPI00006CBEC5 Cluster: acetyltransferase, GNAT family p... 31 10.0 >UniRef50_Q8KD82 Cluster: Putative uncharacterized protein; n=1; Chlorobaculum tepidum|Rep: Putative uncharacterized protein - Chlorobium tepidum Length = 59 Score = 32.7 bits (71), Expect = 4.3 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +2 Query: 200 IRSIYFFKLVQFLYLQLFFCQIFWLFY-FYVNLNFL 304 I I+F V L L FC ++W FY FY N++ L Sbjct: 4 IMFIFFIVFVFICRLLLLFCVVYWFFYCFYFNVSVL 39 >UniRef50_UPI00006CBEC5 Cluster: acetyltransferase, GNAT family protein; n=1; Tetrahymena thermophila SB210|Rep: acetyltransferase, GNAT family protein - Tetrahymena thermophila SB210 Length = 251 Score = 31.5 bits (68), Expect = 10.0 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = +1 Query: 217 FQARTIFVPPTIFLPNFLVVLLLCQPKLFVNVKIIVSQVFAIV 345 F T++V T+++ NFL+ L + +FV+ I+ S +F ++ Sbjct: 47 FIVSTVYVMTTVYIFNFLLGLFTSKNNIFVSAIILASFIFFVI 89 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 379,782,802 Number of Sequences: 1657284 Number of extensions: 6581197 Number of successful extensions: 16070 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16004 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 26870548160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -