BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31007 (477 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces ... 28 0.64 SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizo... 27 1.5 SPBPB8B6.04c |grt1|SPAPB8B6.04c, SPAPB8B6.04c|transcription fact... 26 3.4 >SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1502 Score = 28.3 bits (60), Expect = 0.64 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 99 NTKMMFSRIEENVYTVTVHILQLKIFCT*VGMTILGQYIFSS 224 NTK++ +R++ N+ +L+ + C G I YIF S Sbjct: 568 NTKVILNRLKSNIEHAKTSLLEAAVNCPLQGYLIQLTYIFQS 609 >SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizosaccharomyces pombe|chr 2|||Manual Length = 778 Score = 27.1 bits (57), Expect = 1.5 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 224 LVQFLYLQLFFCQIFWLFYFYVNLNFL*MS 313 L +F L +FF +F+LF+FY++ N L +S Sbjct: 284 LARFFCL-IFFPFLFFLFWFYMHFNILTIS 312 >SPBPB8B6.04c |grt1|SPAPB8B6.04c, SPAPB8B6.04c|transcription factor Grt1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 648 Score = 25.8 bits (54), Expect = 3.4 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +2 Query: 212 YFFKLVQFLYLQLFFCQIFWLFYFYVNLN 298 +F+ + +LYL+L + F +F YVN++ Sbjct: 431 WFWIRIYYLYLKLMIFRPFLIFLAYVNIS 459 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,741,413 Number of Sequences: 5004 Number of extensions: 32315 Number of successful extensions: 61 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 184476110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -